ELFIX4H4 (440000``H44/usr/lib/ld.so.1+JgNdxboGtB3wp'1[VRR@2IM CaHM?{*oz/XNA4"U;OIK&!hw&ep0kLB~%fvlG`j,6ElZf=# .)^FQ+ UYhFT\: !QW,=uSnmKm-2:-/ _Y} A;7#$XZaDS0kr~n8Vjs(d%1}{\5v`Oi|cy3t_x964u<Lg*C]z.?PH>@8q[$iW5y^| 7sT>ce9J'Dr"<()qEPb]0DDIXTά θ    04֠1$1F  F$t&F(18XB@|N \w\pIXtwVF,8Ҵo8|lF00p@8F4F8xN8 -O<;θ Iw,UD\l,tb|s4NX@T PxN\N`!\`NdNhp`{p RhxxgX@08ch?ӼDTLOtV^@[u0tg#uԔ}"ՐRl_0Rp"Ӱ,PNl)Rx 1T=4Q!Z"TisT}TdLTK\0@TT)T0;XpG NDX]c\<q<4y"PL4eDJ$xe d |"l d&</T7Ґ>F`NX$`tf$`kTv]l(h"@ԈTK|"$TTXO$lP T +Z7R@@ hJXYmk((uՄ{0UlZ`Qtր P*@ 8X JZ*$/\\T:rG"LP_0jZqp}ZaL, tZrZ!H4` e@d&H5`X?FO\HVZb!jpv\ԬbZZ PRDD<`8`Әxc <,p ˸ @H !Z ) .@P BT JӀ RL ZX gl rZ zӤ    $ w    "D SPD Z # 4 D ^ dl u $ '4 6X >|0 G P< X^ _p4 o^ w< ~@ ^@ `8` b 8  Z\ b b h $  b  ( l b RX < + 1$ > Hb Q4 c mh s\   H b g g 8 մ n` 8 ]@X n< g ep, g  1\ 8$ >@T GՐ Ot Y `Rh! h oҨ vg& g g kP g hp  ht hx 4| h|x H   ӌ |P L t   8 wp< # (, 5  AԸ Fm  Tp, c4 p  yX nD    S Ԡ qX ,, ҄ m4 ŀ` nX xn\ _\D%!2`t:8Cn`QnX`g n$8w,}o`Px\<"HU$ooP1o#p)o4T>EZNUp\Zc j͸||o]<o@,Kdp(qhμ THp "ePd+o2@N0Ux\i v!HhDTI ThPTLKdRx  oɐ($ +@6o : G(Rg0Wdm0(uo|o֌o\^d@8ըHް, oi "o 3f?hPFp KX$W(_pin\Hu ~pexά  P X"V+@\`e,ppP qxD<)pl.Ҝ4xl?0Gܸ\Pk$WS\`oxpv|<xt՜scr_viewsocketASCII_FILEwclrtobot_y16updatenoechohelp_textinsertentry__DTOR_LIST__update_instructions_start_mbaddchcurscrisendwinsigemptysetreadadd_parent_to_menupathdn_compcallocCOLORSforce_doupdatereset_shell_mode_change_colormenu_loadKEYWORDSmenu_entryatoicurs_parm_errpaint_windows__CTOR_LIST__w32echocharrewindolh_attach_hookwgetstrdeltermscroll_belowXdn_expandrecvwscrlendwinfield_setcurrent_screenMAINTAINERMouse_statusinitscr32acs_mapviewed_gethtbyaddrwnoutrefresh_environ_endhandle_interrupt_eventmemmovederwinforkolh_attachgetpid_iobselect_itemHesConfigFilereaddircswidth__flsbufMODIFY_DATEbeep_GLOBAL_OFFSET_TABLE_field_valuewin_below_curs_scrwidthcurrent_promptviewdocpipesigactionset_com_err_hookttimeoutdelete_windows__ctypeDO_KEYWORDS___builtin_saveregs_use_env_called_before_getshort_slk_initabortputshortgethostbynamehist_oninit_hash_tableshow_help_messagedo_keyword_startupfilter_quick_ptrOLH_ui_viewer_waitwgetnstrreset_prog_modewin_labelwin_abovesignalstrcasecmpin_word_setatexitwstandoutexitOLH_ui_help_keywordimmedokalarm_get_field_namecur_strscreate_windows__builtin_saveregsttynameattach_done_hookcurses_shutdowndirectory_load_entriespaint_instructionstolowerOldcolorsaccessfreemenuPOINTERmallocmp_sizesprintfdelkeymapp_querypopen_resmenu_lines_mbinsshiftnewscreenunamecopy_module_countcharDef_termopendirtop_entrysendsound_bellbit_attributesCOLSres_mkquery_initpaint_menuwclrtoeolerror_table_name_frst_strs_do_slk_tchwtouchlnw32attronerror_messagedisplay_keyword_menumemSset.umul_change_videofputsset_current_screenh_errno.mulwsyncupolh_attach_done_hook.urem_outwch_res_opcodescurrent_instrwaddnstrtermerrcbreaktimecurses_initFILE_FORMAT.remmbgetwidthscroll_abovecur_numsmenu_file_save_res_closePARENTdeleteentrymenus_loaded_getnishost_do_slk_norefreset_com_err_hook_delaywritevp_classSPup_to_prev_menu_sys_nerrcurs_errnofind_groupvfork_tstperasecharOLH_edit_bufferdisplay_bufferwsyncdownwclearvsprintfmbscrwwin_entries_endwinhes_to_bindlog_viewqsortdelscreenprev_abovewin_messagelog_startupwcursyncup_endhtentsys_errlistfclosesetvbufgetenvOLH_ui_help_primarydn_skipnameres_querydomaincom_err_scrmaxdup2group_file_locationgetcurxstrncatgetcurybreak_colonsw32attrsetTABSIZEwaitselecthes_errormktempwinsdellndoing_keywordsstrncpygethostbyaddrcur_termpaint_messagecurrentNoRetryTime_DYNAMICfree_fieldsscr_primvidupdateerase_messagemain_menu_loadstrncmphes_init_resolvenewmenu_csmaxresize_menupathNODE_IDprintfexecl__iob_sys_errlistGROUP_IDwprintwexecvinvoke_k_itemNODE_LABELcurs_err_stringskillchartparm_useidlnres_sendctimestrcattop_pointerpaint_promptstrncasecmpioctl_gethtbynamemax_lines_setidlnconstruct_contextinet_addrwrite_get_field_valuereallocstrrchrstrpbrk_first_term_virtscr_rip_initsendto_dgettextadd_to_menupath_blast_keyswcscrwmake_parents_menupathprogramattach_hookLINESshow_context_pathfdopen_exitfp_query_flsbuf_branchtoexeclpenvironwgetchperror_frst_boolsFILE_LOCATIONerrno_ringttytypemenupathunlinkLPTLNFORMATTERtputs_frst_tblstrnewwinstrchrpcloseres_initputenvhes_resolveinet_ntoafreopenvwprintwp_rrdisplay_fileinvoke_itemfreeterm_parm_errdef_shell_modepointerEntry_et_listfind_keyword_index_frst_numsclosesetuptermpaint_suggclosedirOLH_ui_messagehashopeninit_menupathp_timeMPARENTdirhook_type_translateTTY_chkinputyp_matchfgetccom_err_hookcurserr_getlongcurrent_inputbuild_menupathstrcmpsystemwrefreshfgetscurrent_messagekeyword_levelshow_message_doprntsubwincur_bools_mbvalidwin_view_waitacs32mapyp_get_default_domain_edata_PROCEDURE_LINKAGE_TABLE_FILESYSTEMfopenoutchcount_sethtentmemsetsys_nerrget_keywordmax_colsdelwin__do_global_dtors_do_slk_refget_number_mbtrue_ccleanupfcntlwstandendwait_for_keydel_last_menupathw32addchinvoke_olc__CTOR_END__strcpyselectionmenu_initmvcur_quick_echoinit_acsstdscrinitialize_menu_error_table_etexttake_bug_or_suggest_lib_versioncurses_versionkillfflush_makenewprint_module__do_global_ctorsp_typewmovememcmpwaddstrhelp_filenamepaint_bugsdelete_char_from_buffer_ctypewin_headingres_search_outchcom_err_vascr__DTOR_END__resizemenumaincurrent_menures_scanputlongwcountCOLOR_PAIRSres_query.udivscr_suggechocurrent_offsetp_cdname.divget_tokendirectory_load_entries_comparmemcpystrlentinputfd_setechowin_sugg_waitMainLoopterm_err_strings_init_costs_imageTYPEgethostnamemkstempwin_instrstatmbeucwtouchwinprev_belowhandle_resize_event_finiinstr_textwerasetypeaheadterm_errno_res_resultcodesshow_infodirhook_file_loaddoupdateAUTHORwinOLH_ui_update_menus_gethtentmenufstatwin_promptfprintfnocbreaktgetch_mbclrchmenu_file_loadscounthostaliasIN_KEYWORDSisattyconnectlibdl.so.1libsocket.so.1libnsl.so.1libelf.so.1libc.so.1RhN^V `8RxZ $E0<HT`l(x6҄qҐҜҨLҴ+k*e,54Q ,8_DyPG\Dh2tӀӌZӘӤӰdӼSISY('4@L\Xdp|ԈԔYԠnԬԸd B$0<HT~`l.xՄՐ[՜ըմ;p1 ^,8:D;P\xhtUր֌ @D# @&"@"@a2, @ h"@y@@㿐""    @!㿐@? #@`8) #  O @+ @ h  P@ 0b#b & "b b & @"@ 㿐@u@$n@㿐"`@8@8?&!@ l@ l? l@3@1 l㿐@ Ё㿐@#㿐 @3 @a@3ǒ`@U@0@3ϐ@2@A@3ɐ㿐)+c?%    @# c%$"cА   @#{ -% $    @#s /%$  " p!$#   @' #ܒ$##`*"c"   @' #ܔ`$#ܓ*`""@   @'#ܔ`$#ܓ*`""@   @'#ܔ`$#ܓ*`""@   @' (#ܔ`$#ܓ*`""@    @'v (#ܔ`$#ܓ*`"p"@c  @'h#ܔ`$#ܓ*`"l"@c  @'Z #ܔ`$#ܓ*`""@c   @'L #ܔ`$#ܓ*`""@c  @'> #ܔ`$#ܓ*`""@㿐#ܠ?  , @?,  p? #Б, @?, 㿐 4 < ?@h"#̔ @2 #@W`@]""@ " @@@㿐R" l*`@@?!  @2 `@b@3 @/   R-/""Ԓ@2y ;,* ` " @`ta(@Y`    *@@Y6a0 @@Y.a8  R"* R  >@ba@@2c@/Ԩ  " 4  #` @2+ "؀  " `@’aP  @ah  #"؀ @/Q """`&  bp @1    " bp@a "p@a   @/#"p" 㿐! l @1Ӕ "`@r l"``@k l㿐!"ܒ @1 @/"#``@Z"܁㿐!@X##@Pa# @1 #@Hb# @1 #@@bP# @1 #@8b# @1 #@0b# @1 㿐!@*##@"b# @1x #@c0# @1p #@cp# @1h #@ c# @1` #@`# @1X 㿐!@&#@1#@1",""\!#У. @%@@1x@ !@% l@1q l@ "`'?b!X"b @"b@1\ -%"`/@1Tl@/l@ɢ, <     2``)   )W``0S@13",  !",`? %*L` @~`@ ?4[ja' ,`p *L`  @"@!d `@̐@e p@ʒ""""@ p@?Q @\ ?H b@`@b006 ^9"@ E5`'*@*L` @`,`l@+t:`* @5 ?,`l@+i:`""@0 @0"@0"p ?'bP@}`@P  O""*"`@0 l@㿐 @\+ )?R" l*`@ `+. *   @b@W= 2  `値`  ? . `?㿈@:"p@5쒒#@0"`2"*`:` l*`""8""*`2@"h2@""@"" @V"b㿈R" l*`@'. * ` !@?"@Vƒb  @7"@Vb i@ 좒 !@'c#@L0@ѐ"`2"*`:` l*`""8""*`2@"h2@""""@`tb@V  .""@`@1袒耢  #@@@#@`p@@ `p@b`p@@ ` p@E@Ξ@@ W p @ @ b\@} '~#@ !@ Ґ"#0 @c#@͔@@ 㿈 b`'*b` ' l@*%'"`@/jl@-l@ "4' 0  .0/+0,+ 9 '0@/L",% "@ *@ 'l@) 7쀢  ,` $,` * > !@"` `,"`#㿐    ""3W#D/+"H"p@/`l@->`l@}?, <  }* abbbbbbbb<bbTb<bbbbbbbbbbbbba<bbbbbpbbbbbbbbbbbpbbhb<bbbbbbbbbbbbbbbbbxbaDa\aabbbbababbaabbbbb,ab<b4bbba<bbbbbba\abbbbbxababbaabbbbb,ab<b4bbbbbbbbhk``i  e `  _ ] [ ` + R P N `L  H 2E D A ? A%b : 7 5 7%b1 / - ⤀ 2) ( @.3",#       2 "#  %b ,:  2 %b' ? (@~ l@. l㿐! X 2@ P$ X@] X㿐! \ 2@ T$ \@N \㾈p P "` "` "`  "` "` "` 2` *`@ @ @!,#8+ `p@ 0@耢 @  @@0#@c`@ 㿐 @: 0   @ؐ# 㿐 #'#`@-J ⴓ* @*`, @`@@   `㻐b@7@㻐`@"0@&b@h@:'Ȑ '̐ @6 2 #`h@1耢?2 0@ `@? 2ꀢ 2 `O4@   P@ @ @ِ?""@"#" @Ő?"#" >v"\Y!'̐ @ p@ܐ'А 'Ԑ @ؔ @ h@̐'!@@В / $#@$#J@ /А`"Y#X'Ԑ @ Y!'Ԑ @ ~ 2@x?*"`@q"@@  "@q"@n#@k#H@h#p#@@U @ q#@ l̠ #@Ҕ}@D 2b"lRb"8*"@"*2"h2@Cx@#" Y!p"bY! "b@ `@Q@ 㾐 ͐ '#/%"1  x%    "_b  `<3 k<0M   u B<0( P<0   xN p z<0   v b<x#< @`T▀  !"?@h4"T" "$b%T░* R@$@ `@`@` `}`@! y`@ u`@Fq`@J b 0`g`b  _`@8?b }U`@jQ`@*?M`@& I`@qE`@wA`@=`@9`@4 4`  T%✐ $$b@<#<T l*`@? $ T▐@:``@`* 2b - `@ ` 㿐@.$"`p$"*""㿐"   p *, @ , 㿐" "@C`@1@ p " !d""@  p& p p@b p@㿐" " p*@㿈 @bİN R@b L@#@`p " d""@`p$`p pJ@   b@#@#@`p`p , @`p  @ @`p`p @*@`p @y@@ 쀢 쀢 '㿐b!"b p@ $ p㿐 p@ @ 2*㿐 @@#@>c@w#@@# 㿐@*g @*d @*a"@*^"p㿐#`J#` @L  #`@V@*H"܁㿐R" @t!H0 "2"*`:`@"""R""*`R@"b"b@ @=㿐R" l*`@?" ! `" """` 4 b " "b""      #"#"R"b*"l2 㿐R" l*`@`"" g!՞""?`  4#"` 4 b " "b""      #"#"R"b*"2 㿐*#`@)"܁㿐R" l*`@?"`   $- ' !+Ubb* R""@"Ԓ@)# "@# ?Ub* R %R""*`R@?"b#!"""@bԒ@) b@#ؒ "$"" ""?` " "b"" ⤀@6` ""  `" " &"R"b*" 2 @("ԁ㿐R" 2 "b" ""J@( 㿐!`""!@  "!#`@@("܁㻈 #X#h$@ 'ž @ @/*-$@ @x "@T  d@w'@O#c@z@@#@/c@3쀢  #@!c##^"h c@c@R"c? $c @Lc? $ *?* :  0`* {{{p{{{{{{{{{{{{{{,{{{{{{{{{{{{{{{{{{p{{{{{{{{{{{{{{,c@c@C c@`/ c@` @( c@`8 @$#c@`Xc@`hc@`xc@`c@`m #2 㻐   !!(@!H #@ea`@0}@a`@`@@Z@`2@Q@@K@a@9 pR""*R@ l*@* * ` @ ~a@@aa@!@_aв/%"@C  @?@O@@@*}@Fa@@B@C x"'"''@:@;?  0@"@ϐ" ?@@ @) "H@(@ڐ"`@ @Ƞ"p "` "` "` 2` *`@M#@! #8+ #bb@@ڔ#8+ #b@~ 0Y@@"آ"@? @"0c@Ӗ #8+ #c(@  @e! #8+ #c8@[( X#8+ #c`@1 0)@``  &#@%c@G0@?XX  #8+ #c@ @1@}X*@㿈R" l*`@'. * ` !@ N"@LՒaP  @ F"@L͒aX 1@찒 !@ 6c#@ [`0N"`2"*`:` l*`""8""*`2@"h2@""""@ i" i @T@ b\@ ǔ '~# !@!p#0 @c#@ @@ Y@ 8> 㻐a@@㿀a@ @K#@!#@ha @j @$@ ?@w? Ȑ@㿐!@ " "  @%I " @ b R"# l'%b  @%6 ,  @✒@ b  T$b Ӑ z#ΐ 㿈  @@(@@J?  ,u /-""f l" h+@l @" ,@젒쀢 #@c㸒@ `I @1@Kc0  @)@Kc8 28@ݒ蠒 㸒@ D@-  2 %2,",2@"h2@ *  ` @c@c@Ԑ ߑ, @.  2bR""*`R@ ` P0R" l*@"*R* , `#@ b b  @$p @bb @$`p*    \ '-` @$X  `@$x @2F@ؒd 2@d ;` @$>  @ `d@* `  :+` @$,  `@$L 耢@2  @h 2 ` @$ @ `@$3  ے  V#  R""*`R@ @a0+R" l*@"*R*` * ?c  $#@%b@Jb " @b@Jb  @Ēb 0@"p?c ""x"?#@c?c $@@̒ /?c $@ $?#@@ "@b? ?@ b@?#?#@b@yb/?#'?#?# 8%?@#l@ l@": 2%O @R#@Z! $#*b@F@ @!l?c, @R@ @?c?# ?#c8*b@$ 0-?# 2?"b? @ @!#@?#?#@X ?# ? ѐ#0ΐ#0㾠R""*`R@ @`@0&R" l*@"*R*` *  !@ "@I``  @"@I`h @`p0\@0H@ +@T`@@b@`%P%br@"l@ 0l@!m OP АP@>`耢 " 2 U @ @ lܐa @tP@@ `t@{ <!009!Hp !J!  !x *` *` *` *` *` *`А@A @>ra2 1 1 !@7@ ! 1!@ "  !1 !㻐N @ !@ p@ p@"""" pӞL""? c@Ԑ0㿐  @j 2X@6c  ')ร,  @ 7  ,  @cL  @G @> 2)@b@H` @c@o !@@"`@" &@ @c@㿐@  @ 㿈@`  @  '@  "`$# " @   @ْ  @=쀢   !@4㿐    !8@@@'  @<)+-',`,  @s"@GaP % @g"@GaX 2`,`,  @Xb@G  ` @M@ก㿐   h !`@_h@Ӑ  @6: )+',`,  @"@Gax % @"@Ga 2`,`,  @b@G `  @ะ 㿐@#c)* @*` @'@* `   @z   @sc` @*@@ǐ? #㿐L@`"y @ 2,"yL @ " @ , L ",  "L,@$ @D@T @B㿐N`"y @  "y N  2 @'Jby  "yJ 2*㻐   "   #'`, @+ ณ, `@  &@@"@qc  /"y$@ "X@O  @@ 2 @ "`@ *` @ّ* @`2@"`@* @@*`@"`@`"@` "Q"@@ ,* "@O  ,@,`4@_@@ @@ 27$@Ɣ " @O  " @Ԑ     ,@ 2! @*`$ ,@" "   `&@ #㿐@` 1 @|`؀ 1  @s` 1!x   "+   #'`, @R ณ, `@)  &@@ "`@ *` @* @"`@ "@ "@@ ` @@ b@@ b@@ c@ޔ@@a @ga(2 /#쀢 ϐ@ߒ0 "y/$@ @@`2@"`@* @@*`@"`@`"@` ""@@ ,* "@@@J@  2*@@wئ4@@@?R"@,@,` @0ؔ@y @a0  ,@ @b@j@@,  b@aܐ@l@naH@k@ c@P@ b@I@ `x@@䀤 ,@* ` `@4r@;@K @"`@  -@ @1` @}    ,@ 2! @D*`$ ,@" "   `&@ #㿐!@R"@N"@(@h}#+) @{iL . # ~@ޒ@aP@ݒ @Fh @@`@*` * ? |@ ` @X"@` ` @h"@x b@c@@Oh  J@ _"*@`J@  _b@~a@bl@t0@@`@  h@ @ 㿈@m@} C @g@Ӓ : 1'~,@`l @0#a찒@0' &@*` *  1@@"@D @ &@*` *  *@&@@ 㿐 &@N:2 N. N(㿐`"'*` @ : 2    @ @! $ @@ $   9/  * 2  & @  & @  `&  @*`&  &  2&* ?  @@ѐ  $ $ @ ?&#㿈*   @   @ "``@ *@ (쀢 1쀢   ޒ`1!㿐& 㿀'D'H"`@@? '"c@'~q#䀢 H 2"bD@Қ  "cD@Ș @_# @<?@䀢 `Ej!t*`@lllllll $llllll0<llHT`&''~"# '~# '~# '~# '~# '~#'~#'~ #'~ #'~#'~#'~#'"D€H ?5b0c@`L@  @ےa 2dcL 1'~X#@0 ` 1'~P#cL  @5 , 2>L@ 1'~3#cL  @  ! `@0a@@:   1'~1'~ ##㿐@w  & @  #㿐 *  А  , 㿐 @   & @O  & 6 & .`@ @`*`&  , *    , .`@ @L*`& &   2&#쀦@  *` *  &@ *`   @*& 㿐` .`,   "*   @"*  @  㿐.`,  ]  "?*   @*  㿐@H0@N@㿐 `$!<*`@NL@ @ؒ   㿐! "` !ے "b!Ւ "bl!ϒ "b!ɒ "`"Ò "b`" "b4"  "b"0 "c"@ "c"P "b"` "`"h "b"x "`" "`t" "`x" "bX"{ "b\"u "bX"o "`t"i "b$㿐3b b&&b @6Ac. @@x ', @@@   @  "a@>" !@@   22` !@   ]"c@8!@~ 'd@Kd@B 2,c@˘# @a@h = 'h'lp @S a & : *   ! & : *   !` ` " *  #9# a p  @<h a$@7 @ "a㻈# " ! @ '@@ݒ 2* c @e# @\a@ x   "Ѐ'  8, Z@ ' , `2 ` ' @H 2' Ȑ`   @ * " L@5@%@!`(LȀ  N 2  c @ d 0. @ d $  0@  0. @  0.. 1 !ȁ 2 ׆ :?" *@`:*@ !㿐 `!@#!@#` u!@#!@{#@xcc? "c @  " *cc? "c @  " *@V#㿐! m"#!!x@E|a 'Dm""aHLP  m ᬁ m 㿠 @ w㿠 @ s㿠?@$㿠 . @㿠 @N @T㿠@5  㿠 @㿠"DJ#Ȁ ?bD" ?  2bD " @4"bD-"bD-bD-bD@ Z"b 㿠V 8$ <? " @V  2  @ 2 V '`/  D @)@"("@' '`  @%7`8`@@2W`8"(@ @~ D@| @z ̀ "  2` ``2   㿠b @3` ``2%?DLˀ@@;?)" 5  " /wD @ ",7",",V & R@R`V" w"D @!bDJcʀ`" wD @h?",c , # ,",`,"1%DT61)"DM 2 1",w  @o`, $ ,1" 6  "7wD 9@" * / ! % '*` * +",@M, Dw @xP䨀" -+wbP @ld-P" 31"P@ $w@^ 3bPe" 97 P@ w@O 9 "@ ,㿠! "D"DOd@)*"D,$RR 㿠J!Ԁ" b̀ "!@("$"c    @N 2@RV@ 5@(`@ǐ  +aԒ @ 2~c  @ @ 2`  @y @v 2`  ;@kcȁ㿠@" " 2  "?DJ 2)b,`, ")!" 82 )!w", @`,",$ ,)"DM 2.b `2``".w"D @ b `++`.'=`% 4!̮!!Tf!6ha" )`&ba&_a,R 6Ya&Va",S @ 6PaDT"%  " 2%D0"" )w"D @Z 0w"D @S T2%a&` 6!a`  @@@ @ؐp@zka&!&!,R 6!&!b,S`@ 6 ! @!"D X" % ?@K%Dp" !  @?! a&1?4@)"D@ \ Pw@ ܒ @ @4  @G 4 ? @ b,2 b,2@ 㿠2 'D "X S D#,DTb̺$pT`F2!2 w  @ @   @㿠@ @o㿠"f  !&@"̒@R L"̸ T b&"̒@R N"̸T `#bT`h 6G&DB6'D@ $w@ G 2 6 +)"D@ !w@ 7 " bD@ aw@ -  6-DTbD`t$  '`w @ `<w 㿠"Y Rh @R @bS`Pa6 ! @A !"T P 62&/-6'D@ UHw@ Ւ  6)w"D @  0 @    @  @^ 㿐'D'H'L"D l D耐 2H! D",RS耐 + D  "S+ 8 HDDl "!"D"@ "  #@b#`@b`" '#@b@bb̴ @R`R]-%- %+'32" DJ 22 b, `, "DJ 2"+> 3`@>+`2:& + M 2 2` b,S` 2 `bR`J@ "S J@   %LL2 bR`d@RdbS`d@6 %"D@k!w@   b `2``"w"D @  b `++`$@'`w"D @ "@`<@f -  c%,`$@'3+2@" "DJ 22 @, , "@DK2@"1?  2? *3;' * M 2"@`2@  ` 2 ,R 62@  `bD`lDlw@ e ` ` &  㿠"D `2 D䀐 2z!"D ` ":! D("(!@b䀐" !@" @"@6!@b䀐"  !@"@""!'"@R`H"̐@T T2 /U^b1R`^/R^6 &bD@uaw@   $&!w"D @  ( ?`h@{=?" ?! "  `L2  "  L3 @{b! @{^! @z$"L2 " @z$bL2@"P$ f @  6'@'@`' @: %= @{a-@{D₞ 2 9"D" @@3"bDJ` " ! "P""P""!"D#"D" bH@{o"D"D"D("D "@{ebL"D "D`(l" "D? (@{ZbP"D"X$bP O*` '@@"D$ #$ `,O"D"42!"LDS Ѐ?2DK2 bDR` & L2ba # O@. " @zj2`D⨚@ "⨵. 2 `D"``*bD"e?#dܰ . *`  && ` " `@z7"`2`bD`Ā "`"D@z& Ā2 `bDdܖ* "dܺ` `*O@! "D \#$"D h"$"Dx""D#"D$$㿠?6"6"”?&" &"!6"6""@zg㿠D℀ bDbDb`@yR"l 㿠bDbDbn`@yR"l 㿠V V '& @㿠bh# 22 "h"@zqb)#c% @zi#% cT@zc#D% c@z]#p% c@zW#% c@zQ#% `@zK %  D@zE`T@ya)-U"V- @yW`\@yR?bD"bD"b㿠V   @[㾨'D'P 'T'X Da̺#     %+# / "/Ҹ N``&`  ^ȑ* {a T\T<\$\TTTTTTTTTTTTt,DTTTTTt`:O t/tO@`  F`X.O`'`% &` * {c "`X2ڐ&` `Xt.@x.O"% O 2 %& `d쀦`oꀦ`s耦`x" 7 "DTbD`l""DR " 6 Dt "bD`t""D P@2ؒ@x= %ππ "΀/&  ˮ%خ%@x &  خ"/  ذ #Hذ #@CPذ =#Tذ 7"@Xذ 1"\ذ +#@`ذ %"dذ "hذ # `N`&`1 * |c (@Xp򸀦`12  jO@`a&O@O@z4 O@O`+ & " `X%`A&VO@O@Z4RO@O@ؖ  & 2~`G%O@`a&O@O@z4 O@O`+`  "`5`A&3O@O@Z4/O@O`ؘ   `S?~$"O`ذ `"@O```'"O@! O@  - ` ?O@`+2 O@`.&0O@``0`9$.`}" @xذ #ؔ& & %% خ"؞& & %% #خ#ؐ@& @w& %% خ"@ؐ@& @w& %% خ#ؐ@& @w& %% خ"@؞& & %%  خ#ؖ& & %% خ"@ؐ& & %% خ#@ؘ& %%&    p"ؒ& @%%& @    ^#ؚ@& @%%& @    L"ؔ@& %%&    "   7"ؚ@& @%%&    "  $" 2  #ؐ@"خ%&  2O@ e@  ;@  O@`2(`%@vV !*` :`J @ `;2`? `?"``;"#`J  2쀢`% 㿠'LbD P`,"y    "D ܀ 2   N  "N/`/`@N N '`0 2/`N/`/`.@ N  "N$0N  N`/2N  *2  "N@vN>L DK"@@M㿠# $`PNN$ N  <ƀN N2N 㿠!3"," ,@v_# @vz ~c@v[ ", *",@ǁ㿠@vO 3",# , 2 @vc@ut㿠"D"6)?&?D"! $ "D"  D⬞2@ %@ @%D$ 㿠' D @v+Ⰰ`)"D "@v㿠+/?bDb 5b75D.  d@uؐ c"D/""D  /c "D *b"D*"D*#K㿠"D"@u&@u"?@u D"㿠?"D$쀐"  /`3?`@ F@ 6` .`>` 6 . > ?@ "LS ?"LS+@2/@".@" @$?2'?D44@"@  @  @㿈'LDb 4 2LD"L⤀S   ''9'`%  - bDb " +@"@#  ?@ "`  ``,@"%Ԯ%2 LbDb4 "!    #`"D#h #d#\ "4@  ޚ  _j?DK2 @bDR` &@@28 @"0@=#2 bDdܒ "   "D? Ē 5@?@ " ?D #@.@ `,@@@" ?@ "`?bD@d  @"``,@bDR` $ D `"D#"㿠. "D> "D$+$)"P$" /-PW ؔ/P堀2?7P圀2?bPd 2 ?P一 _?7`[7@!"P$" . %P ,W`. V ""V3bPe"V "P%bPd "V V *`Pl@ V 7`VW@ 'P圀"-+VbPeP"VV3.bPl d eV7@㿠 N N #.  . . P3Tb@ `@ V  V@Ȑ?"+?%LĀ""@&. . @EsV &<N  N 6 . ̒^?" ?@Ő?2. ?. . VV T$`  D/ /`@@ `"` @02` . . V~V 2 0!@" ,%? ,@ #@/  D/`@"#V  T@6  2@ R@ $ D 3 D!@#@"(" V %3@4  `@2 V `@ V &2  @? V ?@2360'` - +"z` s w 2' 2v!@s"" $@V 4V @6u. '@/?"m?`,i. 66 N "@2N `@. @lpV  " 'V?V  D N  'N '6 H. P. . #2Rb`$ U@Ȑ"N UU@K#Ā "F` `"C` ``2`  2` "  2  @W@ %'@" @` @ "@&`@4N  @ @ "N 4&``@$@U@ zU S`"R 6NR$@/  - " @@ "fN @R@ 6@2S $` 3` 2耏@ " @- @/ # "("  `@ ܻ7` @ 3   G5@?2 %?U@U5`` ?3'⌒c , ''ܚ 0'Ԫ '' ' '@"N *&N . 6 . N "@* : . @e@"3bDd쀐 "?? , & ,c@ 3@ ,@& , @" @bDd쀐 2@?@ @" 0? 0@%3@@& , 㿠V, V N . N . V $ & V V &4V V &6$`66 @#W@$7@W@@@6 -,. N ".@.N  >. . @ 㿠, 'DUUNU?5HSb`$HDD-`.` " D -P@R?2U?D-  "/D% @&D/`D1"D'`' @6D-`/`  2   2  "  '┸W@4'`D-`.`0%@!U"(" # '#b,2`@T&,2", S&!", T$&`?", 22? " "" 8" %<̧4,8  >` 3 : 2`@: ;  @6>`'@ /@ `>`4>`,4`@<`@.`6 '` N*@ . `b`| "I >`!2`@:``"̀@-` |'@ /@ `>`4 >`, 3`@;`@ *.`6( '` N, @ . ` @R$' 3@'  3M M`- @hM" @́ 㿠 " 2 " DJȀ 2 EbDb 4 N ! 4"D""N  4N " +N 2+@+bDUd2 (/P\" (5wP 7\@p, (2  "  (7```@ 3`6 ` & ` N 2` @` 2 ' 4" 㿠@!?2 ?xD "̦ 'H 'L  Jȩ2 '@H* @: * : 2"&b @**@N 'N 'N '. . @. 4!&'L$-   /'/ '''؀  ؞R +R*3T  W"- 2:02'  H   / %O@%"qLJ@@J$ '` f'`J@@J@WL"TL@PL4@HL- `" @@   @  * / " !+@"" / #O* 2 O5J@n&**@J @" L&U-2b @*@V V &6  @ V 6 . . @8. 㿠  V V @ &V?@ 2?V  "N ?6 HN N `66 . @ 㿠'XH`'H'L'P@'T㿠?", 2   " ,J " # @@* : D  +ˀ ",*  2 ,J "# #+ # b,%b, S 2`j R 3 h `8" ``|"\b,b,S 3fT`2d`4#c 4"f 2 28%wS" wbDa "b@ 2" wbD |aDKʀ"%ww"D"DJcʓ*`  k$%w)"D c  "P]"l"D Ā" DĒ Q " +``+*!cJ` "?HJ "@ swbD R`f/`< , 3,2 2`h2j,J 2 ",AS`d;`3 +@"    R d: Rf2`@: "",",  $?     S`d66``%`" . ``@*@ < < ",*",* c+`b@)% Tf?#@  #3:Tf"`#5 @"&bHJ` "@ 2"7 3"% 42) Dw”  * 3"%wD " *`* wD "D!̀ "Dw  $#wbD `|&#" 2  " 2"% , +%wD g @6/`'@`' ,6  ." "$ 3 #  26  :'& @ 4  $! @ " ` &@!"@eR`@"̸ "&!b `2``" "S ` >` `4`@2. ,`: &@ K,5+ +b,c `,/3 @& 9`) 2>`*5 `=&@  * M `  @@&) U d@&>`>` >` \3 5. + =&@  J+@  8* #b,c-3 `,' @ & 93` \">` 5>`-5 = &@*L@@`  @ @&# T`d@&! 㿠  R f%Rj" Rj.DH 2 .  2   2 `"  & -@ W@.&3@" `&'  9", Rj.,`DRj. RjR`h",3 `, ")w", `,%3 @",' ,)"DM "  # ~2 `T /`O ` S d@  RjRjbHK` "!@!" " % 42 +wbD -`  - ,.S`j+`D  2+  ',U`j-`D 2   ,S`j+`D "  +'bD┺@`W@$%'  Dwl ,'D؀ "'b @`2 '!"D!wR '#3,@,@" !w",`,",$ , ",'`Rj* D /  4  `"# !3ฎ@2 . . )3"# . w ?@"," ,#  ,3 h. T`j ,`D#/ ~ Rj ",*@ D "` SdG!"DL " . ) . # ~2.  `Y Rj ",* D "/ K' #b, Tj,`D@@$@` R dbDJ` DJ " , *   R j3`h2 j A㰶&`㰮 ,2.?W"&&) VU d&  UR`d 6& SdD+@@: @@ 2@`@*@@2 7&%' &Ԭ%㿠+c",`@ ‶& WS`d &  W@?"  7@`    @{%@,W@Udq`` R f@&- 2bHJ` "@bwD R`f<  3`h",ڎ3 jFDD2# #bDaЀD'DL ?# ! T j. T`h >`4 j4`h"HJ "@.DD " "D  DDR`f"@] wR`f"@ِ",4",4`", Rf#  @㿠%P)"DU$怐-wP ?9"D;?c?5"D2$", , ' ,㿠 (2 N "V $&?VN @. N .  V V &@46V $66@ 6 6. N "/ @ / ? . " p" @+  V V :V `6 *67 J/ P7 H " " "㿠. c > N ;bP*@ "`N N w. @ /3@Zc,bDNcˀU 㿘 DDDd+#DS䀀$ O@#bDTd$4d  '2 ?@' O@ /`'"O@D JȀ "O@@& O@O@$ /@'/ `' ,㿈#'HbDbD bDbDbD$`@U"ObȀ`  DRƀ@`.`@L 2` 'K"4.`O@2"O/ @?*`"@?O#`/!"DT"ƬѲ& @*`K 2Ʋ``'` &.` R2U!! ' ' ' ' '"P% "?@"`2` /$ -`4,#a@a@ "  WS! "  #WTa@ @"  /`W* @@Sἀ "  "! " .`@@C`'@K @"3-.`"DR"ƀ@$D"D"W@@$ 'W@ , < 7@', %&'.&&@ ,`@'@'`"'-% -U%@#aĀ`!c 4 "  @I`@&.`㿘'DD`Ẻ`D&`D@"'`@'`/`$7W6`0&`3$`0?"&`@&`@&@&.$7W P`& R C D T"`?`   `   ? @`&`@'`@x'`/`'@* : j & ~4"4' 2' 2@*@&`@%@R%-%* : 6B` &`~ @XQ'`  @XM'` /?-? ,@!W 0" "   2@2 3 32@W C D P耢 Rꀢ T"   + l㿘# bD% @X3ⰸa @X,l@X* bD @WVb@X" Ll#`""'Dⴀ"  + bD@WAb @X@X @W3  @W@WӐ - Ml 8' @W`21 N l"??㿘"D @W" 2?!S  S  `    `S?+"̥,@"̛+@  4 RDRF  $-W@W@a@4  &  `㻠@W?2?U㿠N @! }. 㿈'H"("'"('""(VV $ & V VV & 4V V & ''H 6V# 4'HH V&#@V" &'HV" H%&%?V 8 4  @ 2  V   `'"`7*`'  D5@-@.@@"@@#b, 208"*+bbb88b 8#b8"b`|@"`` ||`|"``| "@-@.@@V,2V5@V5@""  #7@W7@%H 6V'@'`&$N N N . . V 6  V'`*7`. 66 . N  .  " N ""("@"( @N  ", `'D @"@D",!J/",RR R"̒ W`V 'R '"J , DJ "J "DR 6DR 6Dc2c2`D (22Dc `(++`(D `(2``"D# (`@+ (DJ " D *D+ DK` +` DO "N@W  @&4D' S 4   D''b*``$@'@    ' b,D'K` " ?c2 :c2`<  ?7ޘ"┓*`'ؖ?7'Ș '3''O2OV "O  VV 6V O V?T@@$T@R" @U'- @"%-, / @@" '`64'&/ @" `,@4- "*@ -@"/ ' '`6@/ `/`?``2`  2` "  @S@@$'`@&aR$V * " #@ *@ `"V #V"WU2W5 U 45@R&2cS`: 6#2 :cR`< $2<.%@@`@ @@ ̐-`@T ?#b6W4@ `Ę  ''`' ' ', OJ * DK` +`  㿰V V %bV < V : @    '''<'f"5T: @% V"V, V@'@@44& W47V@&6` ,VL@,@T:T<@ @ 2L 㿠V"'`" @ 2@T4' 4"  @T)"" @T#"ٱ*`:` "*  * p"㿠-V,% V M @ V #`V V )3@@@3@N `20N N  2,N ,J 2&N cK` `2 N !%"T $4N +`%`4N " 4"!4JH2!N `. e%$# @?+4@ 6b,U@2 !",R " !",",R`nR",4 b,#` ?3`.b` $@+b,` U@$b,` 2@,R 6,3/ b,+D$c`D@%@b,`, " !w",`,",$ ,b `3``"-#wbD %` ,,-+o=b1@Sx`,#㾈?"c! $## $c#@S2cȤ #$##U$c!@RӔ LO耢 # " N "  " NN   =2 . @Rc耢   #@Rc ϐ #N "  "  =" N . %!@RV@S $@@R?@R@R#"  @RC@RS @RB "c #    "c $#@R#"##㿐#? #l#c L @R @ @R .   @>` 2 $c5 !  p@R p@Rm @* #  p@Q!  p @Q` p@Q1 # " L@J . p @Q` #@Q pL@ .1   p @Qܒ`( p@Qْ p㿈!T $## 2` 2`  @ܖ#o`      "c4  ,  !p  @@R\ $`@  @Q@ @.@` `@ި 1 !p-"㿐@Ӑ @6@ @6` @* 2 &` `&` "c 㿐 !    "##%`%`%`%`    `?, @ E ? ?, 5@Q $ ?@,@` ?, @Qu $ ?@,@` $?,%@ 2 @QY $ ?@,@`$%@㿀  Ȑ ???` 0 # #\#t#`"#d  @ 6V  a "V   " #t1!t@|" `""` "T!t "c J@` ?J " #㿐? @ E  . \'A?@@:<?/@`@, ,*@@ . `@:)?/@`/@@`<@@? @?(@@ @ &@&@ ?`/@ @㿐 @ @ 2` F #?@g ?:`?.  ` `7*   ?@$@`$@ .񀦠\   .   & ?"? >**.2$? &㿐:&   ?:& &㿐'D?' 3 & % ?5??,@@.*\"`@@`"`?<@@ `@ . ." @(@@@ ҂`@& ?㿐( 㿐. . . 㿐.`6 .@㿐.`6 .`6 .`6 .@㺈@P+@O 㶈     $  4  54  $  @O"  B@O! "0 @ObH%  "  А$@OG  bP@O  2! OJ@ "` "`J@ " @O\ @O\ 2*@զ  bX@Oe  2G ̐OJ@ "` "`J@ " @O6 @O6 2*@"aa L   *@ "`&  `J@ *J@J@J@    2`*@& b`@O 2`OJ@ "` "`J@ "r o@Oo ,`@?"`e"`,` 2 52 ]`` " @N !J! !!  @Nɒ .@NU`) ">""   @*:  ." `J@  !a " @N . &?    & `` "` h\`  Ȁ  d "p@N€  @N  aa 2a4 *` ?ސ* 4ȓ*` `@ ? 4ȓ*` a > ?4 ?''̀ "̓,@XXXX?  |$x t  5  ? d a ]  _  U  l5 ` M. I E  G =` @M M5 ?$I '$    " ` @M ('5 ?$$ ?U` U`   ` `  @Mi`` 5 &㼠'L'D'4 ',L'  Ȁ   @M"@UL  Ȁ 2'<??'<  Ȁ  b$'<7&   Ā6! + %    ̀6ά7  ?`Ȁ , А 'T@MT "@L<   %   @Mz  $   @L",`@@Mi  6 7R r @LҐ"0m7RR'X '\L'`'dX@M `  `Ȁ [ @L"0V 7R@LR R"7R*  @ 4`Ȁ  @L#@L`P$,2M ',HD`Ȁ  # @LhcF7R7RR *@L|2 R"7R*  @  `Ȁ  @Le#0@Li$"0D&7R*  `R""X@LOR"7R*  R`    @LÔ  $`Ȁ  @L/#@  ̀ '`$``,`@@L  6    @L#XƦL@L $`Ȁ  @L#`ct@L  , L @L՚     @K#h *'h@Lz 'hh 4'l 'h'lp @LY `&`:`*`@`&`:`*`@  " *  #? p  @LEh `Ȁ ^ @K#p[ `Ȁ  @K#x O'4D@L.   `Ȁ C @K#@'4& `Ȁ  @Kc#@p`Ȁ`  " ` @KR#@Kq$ l'<`Ȁ < @KE#@}<`Ȁ `Ȁ!,@KU($  ̀<`Ȭ  Ā&, ! " <@K@?$"< 4 "c "c"#?㿐! "?@K#?$"㻐  # @K`# "#8"#$@K$ + )@K 2*O # @K ` ,   @K` ,    @J` ؐ,  "@Ҡ #, "@  "cЁ㿈 ' Ī$+ ` " $@J @%@ǒ    `$  8" 8 $" c"c"    $ݘ * 2  * 2  * 2  ` c% @JA @[%@   #`$Z`$   `Ȁ   @J:  0@24쀤 `.'` ' '`'`  `#`$@J @` `" @`ŀ  `Ȁ   H@I %@J@   } 2% "b %1 $㻐L@"y  7#L .2 @J?"`Ȑ k"b $" $`8& "`8 &  & c "c"Y& J@"y  `.  J@ 2J@J . #Ѐ  # :#,  "  & "   @D$   Ȁ  @Ie `  @  @5`x   ,   ̑,  㺐_ #Ѐ  C# S#+#),` "5  <`38` `   @I&   @$   Ȁ " @I  `X  & & %c%%  c"@@F `0 @ϒ` `,` ,` 㿐! #䀢   #@Ii`$# @I# c"c㿐! #䀢`  #耢 @I $#㿐! #䀢    # @ID`؀  $#  Ē$@H䢒2L@a # @˒`ఒ. @Ē`谒. ! $`$  "`@I @"@ $  $ N "  "  $" $ 8"` @`"($.  "#$  # *`:    $ @`" $.  "$N $1 $㿐` @   @   0Xp   ! @I! 2d @H @IЀ X @H 2, @+a, `' "`@H@"@ ' 'L "  " ' 8'ܰ @ a"(&,  "#&  3 *`:    & @a" &,  "&L &؁㿐͐    @H 㿈@쀢 ?㿐@ ` @HL 2  ?@H  0,@H ?L X" #<% /L /2?,@Gݒh ?| 9 ,8L`%@Ge! &@, ,#쀢 # @Gh # `? a"yL  z2 ,  ߐ a  ,"c 㿐 @  @`&㿐  @   @@@`&  @@& 㿐 N H N2 㿐@c㿐  @Fc 2  Ⱄ < c@F  c@F   ㄕ* c@F  @F`  @ @F`$ @F` " @F`(! @F}`0  @Fv`8 @ @Fo`@ `H@Fj `X@Fe `h@F` `x@F[  * @FT`?,%' @FMࠐ@b]`* @p2  @F<`ߐ* @2  @F2`?`  @F(`Ƞ?,' @F!ؐ@M1?  @F`ࠄ?, ' @F @6?  @E`? % @E@ ?㾐bf!O   .//@F㿈 k* 4 @ @Ea _* 2 @m @Ea( Z@  @Ea8J* 2  aH@E ?`e#*`@HœœHHHHœH$œœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœœp`쀤`2G@E]  '@F @EaX65'@F  @E ap a@EN N *N  a@D  @Da  @DaN    a@DN   aД@Dؖ @DҒa @Dɒaޔo @Db g@  @Db^@  @Db U@{  @Db0L@r  @Db@:*  bP@D2  @DbhS "x@ED8   - 2? & \@D & \*? & ? & @D  &* `̀*N0Ȑ"@Ef @DAbV @D8bMR b@D-KIҐ @D!b? <@DR  '@EN  @D b # N `.`b@C  `*N? & @D7 & * @Cb  b@Cڔ  @CՒc㿐 "b1 (e"N1  "B1 ;1 m1;<1 g1A  7 81 \19 :1 V1Ne 81 36dA1 G15 f=,1 <1-.1 619#7# 1 4#(2#00#81 -#@+#H1 (#P1 %#X##`!#h1 #p#x1 ##1 #1 ## #1  #1 #  @CZc 㿐"1 1  11 1 # ##ؐ  @C=c x 1  # *` *` *` *` *` *` *`0@D( <@D' <@D! <@D  <@D @D        c@B L 2 `  , `    ( `@B L 2   `,    @ H `0@Bʔ L 2  `  `2,,   `  h `P@B1 㻀  Ȁ  a?`  Ȁ   p@B#\#`$#d  ]    Ȁ  @Bo  >"b<6   Ȁ  @B]  ,"b   %  Ȁ   `@BI `!H*`@pxh`xx    "b?㿐  Ȁ  ?"?"# "bN   L ."` L  .``@l^`  @W 4R`  Ȁ   `3`L? ..  Ȁ"* "" &`+%) @3 4.c쀢 " "   ` Ȁ"`  ` @    "b?㽈  Ȁ    ؒ@A`@A?N . b @A *=  a!!@Aݘ㻐 @A֐! F @Aa A/"y! $@A 3OL "L  " L %,(  L  2 L  L J@ "*@  "`*@. @A @A0@A} 㿐""   "Ē`*` 2`@ ", ?, 'D'H'L'P'T'X㿐㿠㿐""    @@ސ!㿠SUNW_OST_OSLIB/usr/share/lib/terminfo is unaccessibleSUNW_OST_OSLIBI don't know anything about your "%s" terminalSUNW_OST_OSLIBcorrupted terminfo entrySUNW_OST_OSLIBterminfo entry too longSUNW_OST_OSLIBTERMINFO pathname for device exceeds 512 charactersSUNW_OST_OSLIBmalloc returned NULLSUNW_OST_OSLIBterminfo file for "%s" terminal is not readableSUNW_OST_OSLIBSorry, . SUNW_OST_OSLIBI don't know how to deal with your "%s" terminalSUNW_OST_OSLIBI need to know a more specific terminal type than "%s"SUNW_OST_OSLIBmalloc returned NULLSUNW_OST_OSLIBSorry, . 4 T ά0  DD 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/ascii/RCS/curses.c,v 1.6 92/04/05 17:08:37 probe Exp $֠$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Unable to initialize the curses library. To use the On-Line Help service, you need to have a screen with at least %d columns by %d rows. Press any key to continue... -- Project Athena On-Line Help Service --yMENUDIRHOOK%c%3d%c %sMore topics aboveMore topics above (press 'b')More topics belowMore topics below (press SPC)Please type your suggestions for improving the On-Line Help service.Your suggestions will be forwarded to the person responsible formaintaining On-Line Help. Your comments are appreciated. Thanks!When you are done typing your suggestion, type Ctrl-D or '.' on a lineby itself.Please type your bug report for the On-Line Help software.Your bug report will be forwarded to the person responsible formaintaining On-Line Help. Thanks for letting us know about any problems!When you are done typing your bug report, type Ctrl-D or '.' on a lineby itself.$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/ascii/RCS/get_keyword.c,v 1.6 91/03/14 16:08:11 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Keyword or token id: No keywords begin with "%s".Please type in a keyword to search for.More than one keyword begins with "%s". Please type more characters.No keywords begin with "%s".keywordsLoading keyword menuMENUDIRHOOKloading %sylocating module, continuing.;/mit/logos/lib/help_files/noviewerviewing %s$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/curses/RCS/get_number.c,v 1.2 91/01/25 04:35:02 lwvanels Exp $ $Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/ascii/RCS/get_token.c,v 1.2 92/04/05 17:08:35 probe Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $PRINT (p), COPY (c), or show INFO (i): Send COMMENT (c) or BUG REPORT (b): $Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/ascii/RCS/help.c,v 1.3 93/05/03 14:03:57 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $ascii_primaryascii_keyword0@To choose a topic, type its number and press the Return key.Additionally, you can use the arrow keys to move and select itemsPress the '?' key for help. Press the 'q' key to quit.To go up to the previous menu, press the 'u' key.To choose a topic, type its number and press the Return key.Additionally, you can use the arrow keys to move and select itemsPress the '?' key for help. Press the 'q' key to quit.To choose a keyword, type its number and press the Return key,or press 'k', then type the keyword itself and press the Return key.Additionally, you can use the arrow keys to move and select itemsPress the '?' key for help. Press the 'q' key to quit.To go up to the previous menu, press the 'u' key.Type a keyword and press the Return key.To get out of keyword-entry mode, press Ctrl-G.Press the '?' key for help.`h(`h(0p8px/mit/logos/lib/help_files/The help file %s could not be opened: %s load_help_file: fstatload_help_file: Could not allocate memory Sorry, help is currently unavailable...$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/curses/RCS/hooks.c,v 1.2 90/12/17 12:56:53 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Attaching "%s". Please wait.Warning: Unable to attach "%s".$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/ascii/RCS/interrupt.c,v 1.2 94/03/30 15:46:12 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $handle_resize_event: ioctl: You have made the window too small. Please enlarge it to %d columns by %d lines (or larger) and start the On-Line Help program again. $Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/ascii/RCS/main.c,v 1.14 94/03/30 15:46:36 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $olh_ttyFor some reason, OLH was not able to load its initial menus. If you continue to have trouble, please ask a user consultant for help via `olc' or by calling 253-4435. The error was: in menu_initmainloading main menuCopyright (c) 1990 Massachusetts Institute of Technology OLH v1.0Number: Copyright (c) 1990 Massachusetts Institute of Technology OLH v1.0Please choose a number from 1 to %d.$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/ascii/RCS/menupath.c,v 1.2 91/02/05 13:36:03 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $;;%s$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/curses/RCS/olc.c,v 1.1 90/09/09 13:43:40 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Calling the On-Line Consulting system... /usr/athena/olc$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/ascii/RCS/screen.c,v 1.3 91/02/11 14:46:07 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $There are no more menus up from here. You are at the top-level menu.No topics above.No topics below.$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/ascii/RCS/suggest.c,v 1.6 93/05/03 14:04:18 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $bug reportsuggestion. /dev/ttyr+ No %s to send. Press 's' to send your %s, press '?' for other options: Sending... Your %s has been sent. Invoking editor... Your %s has been cancelled. Options: s Send e Edit c Cancel l List the text you entered To: olh-suggest To: bug-olh Subject: Ascii OLH suggestion Subject: Ascii OLH Bug Report ----------- current menupath: currently selected: Error starting up sendmail. w%s %s%s%s%s Version: %s 1.0machtype -c -d -M -vr, Machine information: %s sendmail-tmailsendmail: error starting process. /usr/lib/sendmailsendmail: exec/tmp/olhXXXXXXolh_ascii: error opening file %s: %s olh_ascii: error writing to file %s: %s EDITORemacsolh_ascii: error forking editor: olh_ascii: error exec'ing %s: %solh_ascii: error open file %s: %s olh_ascii: error stat'ing file %s: %s olh_ascii: error in realloc olh_ascii: error reading file %s: %s $Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/ascii/RCS/view.c,v 1.2 94/04/12 09:06:06 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $MENUDIRHOOKloading %s/mit/logos/lib/help_files/noviewerviewing %s/usr/ucb/more -d %s/tmp/olh_XXXXXXCould not open file %s for writing$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $Path to current menu:ERROR! reconstructing pathMENUDIRHOOKloading menu$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Please select an item first.Information on module "%s"%-15s %s --- pointer information ---%-15s %s %-15s %smodify-date$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Please select an item first.MENUDIRHOOKYou cannnot copy a menu. Please select a document instead and try again.HOME/tmp%s/%sDefault: %sCopy "%s" to: Error: %s; press any key to continueCould not fork to copy: %s/bin/cpcpcopy: execl /bin/cpCopy successful.Error in copy$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $Please select an item first.MENUDIRHOOKYou cannnot print a menu. Please select a document instead and try again.PRINTERDefault: %sPrint "%s" to: pcapInvalid printer name; press any key to continuePRINTER=%sPrinting successful.Error printing; press any key to continuelinusclusterlpr $Header: /afs/athena.mit.edu/astaff/project/olhdev/src/ascii/RCS/keyword.c,v 1.1 91/03/14 16:06:24 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $"%s" is an invalid keyword$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/libmenu/RCS/menu.c,v 1.2 93/05/03 14:01:36 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $DIRHOOKmain/mit/logos/lib/config.menulogos/mit/logos/lib/config.menu/mit/logos/lib/config.menulibmenuin menu_initMENUDIRHOOKlibmenuin menu_initMENUDIRHOOK$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/libmenu/RCS/menu_file.c,v 1.4 91/04/29 11:33:04 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $w%-15s %s r$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/libmenu/RCS/dirhook_file.c,v 1.2 93/05/03 14:00:10 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $directoryDIRHOOKentryDOCUMENTplain_textDOCUMENTDIRHOOKDIRHOOK/.indexrdirectoryDIRHOOK//DIRHOOKDIRHOOKDOCUMENTplain_text%ld$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/libmenu/RCS/pointer.c,v 1.4 91/04/29 15:03:55 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/libmenu/RCS/colons.c,v 1.3 91/02/28 14:32:03 lwvanels Exp $$Header: /afs/athena.mit.edu/astaff/project/olhdev/src/libmenu/RCS/fields.c,v 1.5 91/06/30 18:35:41 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/libmenu/RCS/attach.c,v 1.2 93/05/03 13:59:14 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $olhError forking to attach/bin/athena/attachattach-quiet-nomap/bin/athena/attachattach-quietolh_attach: execl /bin/athena/attach$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/libmenu/RCS/viewer.c,v 1.2 93/05/03 14:02:20 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $viewer:plain_text%s; file=%s; %sfile=%s; %s$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/libmenu/RCS/menu_alloc.c,v 1.2 94/03/30 15:29:00 miki Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/menu.h,v 1.9 91/06/30 18:50:29 lwvanels Exp $$Header: /afs/rel-eng.athena.mit.edu/project/release/current/source/athena/athena.bin/olh/libmenu/RCS/hash.c,v 1.3 93/05/03 11:52:45 miki Exp $%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %% %%%%%%%%%%%xttyauthorkeywordsmaintainermenu-parentlptlnin-keywordsformatterfilesystemfile-formatpointerfile-locationtypelabelprimary-parentascii-filemodify-datenode-idgroup-iddo-keywords(08@HX`hx (0typenode-idmodify-datelabelauthormaintainerkeywordsfile-formatfile-locationfilesystemgroup-idpointerprimary-parentdo-keywordsin-keywordsformattermenu-parentttyxlptlnascii-fileInvalid file nameNo filename specifiedInvalid filesystem namePointer not of form group:nodeCould not forkError starting shellViewer exited abnormallyNo viewer available for this device and file formatCould not attach filesystemattach: Bad argumentsattach: Internal fatal errorattach: Keberos failureattach: Host communication failureattach: Authentication failureattach: No reserved ports availableattach: Bad filesystem nameattach: Filesystem already in use by another attach processattach: User is not allowed to attach filesystemattach: User is not allowed to attach at this mountpointattach: The remote filesystem does not exist(HXp 8`@/$Header: /afs/athena.mit.edu/astaff/project/olcdev/src/logger/RCS/log.c,v 1.8 91/06/30 12:24:16 lwvanels Exp $$Header: /afs/dev.mit.edu/project/release/source/src/athena/bin/olh/include/RCS/memory.h,v 1.2 94/04/16 13:43:28 vrt Exp $tlocS%s %s %sM%d %s %s$Header: error_message.c,v 1.2 89/01/25 09:08:57 shanzer Exp $Copyright 1986, 1987, 1988 by the Student Information Processing Board and the department of Information Systems of the Massachusetts Institute of TechnologyUnknown code Copyright 1987,1988 by Student Information Processing Board, Massachusetts Institute of Technology$Header: et_name.c,v 1.7 89/01/01 06:14:56 raeburn Exp $ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789_$Header: /afs/rel-eng.athena.mit.edu/project/release/source/athena/athena.lib/et/RCS/com_err.c,v 1.5 93/10/23 13:18:09 epeisach Exp $: 1$2Kn,X `%K @@1,bgnT#$" !+,&5MS7) `*a:f'g#o-q-s_x|~o,<+>.v-^h#i#0#4   liorkp-$Header: /afs/rel-eng.athena.mit.edu/project/release/source/athena/athena.lib/hesiod/RCS/hesiod.c,v 1.15 93/10/22 12:02:36 epeisach Exp $/etc/athena/hesiod.conf#r.ns.Athena.MIT.EDUlhsrhsHES_DOMAINrhs-extension...$Header: /afs/rel-eng.athena.mit.edu/project/release/source/athena/athena.lib/hesiod/RCS/resolve.c,v 1.9 93/10/22 14:19:43 epeisach Exp $$0LOCALDOMAIN/etc/resolv.confrdomainsearchnameserverres_mkquery(%d, %s, %d, %d) res_send() Querying server (# %d) address = %s socket (vc) failedconnect failedwrite failedread failedresponse truncated read failedsocket (dg) failedconnectsendsendtoselecttimeout recvfromold answer: truncated answer got answer: /etc/hosts/etc/host.confrbindhostsnisunexpected answer type %d, size %d size (%d) too big res_search failed hosts.byname%u.%u.%u.%u.in-addr.arpares_query failed hosts.byaddrrr#   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~QUERYIQUERYCQUERYMCQUERYU45678UPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREF** *(*0*8*@*H*P*X*`*h*p****NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSED67891011121314NOCHANGE**+++ +(+0+8+@+H+P+X+`+h+p+xHEADER: opcode = %s, id = %d, rcode = %s header flags: qr aa tc rd ra pr qdcount = %d, ancount = %d, nscount = %d, arcount = %d QUESTIONS: , type = %s, class = %s ANSWERS: NAME SERVERS: ADDITIONAL RECORDS: type = %s, class = %s, ttl = %s, dlen = %d internet address = %s internet address = %s, protocol = %d, port = %d domain name = CPU=%.*s OS=%.*s origin = mail addr = serial = %ld refresh = %s retry = %s expire = %s min = %s preference = %ld, name = "" requests = errors = %s %ld internet address = %s, protocol = %d %d ??? packet size error (%#x != %#x) ANSCNAMESOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTAXFRMAILBMAILAANYUINFOUIDGID%dINHSANY%d0 secs%d day%ss%d hour%ss%d min%ss%d sec%ssres_query(%s, %d, %d) res_query: mkquery failed res_query: send error rcode = %d, ancount=%d res_querydomain(%s, %s, %d, %d) %.*s.%.*sHOSTALIASESrSVR4unknownTERMTERMINFO/usr/share/lib/terminfo/a//usr/share/lib/terminfo/.LINESCOLUMNS@(#)SunOS 5.3 Generic September 1993as: C Development Set (CDS) SPARCompilers 2.0 18 May 1992 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993@(#)SunOS 5.3 Generic September 1993as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: SC3.0 early access 01 Sep 1993 GCC: (GNU) 2.3.3as: C Development Set (CDS) SPARCompilers 2.0 18 May 1992 GCC: (GNU) 2.3.3as: C Development Set (CDS) SPARCompilers 2.0 18 May 1992 GCC: (GNU) 2.3.3as: C Development Set (CDS) SPARCompilers 2.0 18 May 1992 GCC: (GNU) 2.3.3ld: (SGU) SunOS/ELF (LK-1.4 (S/I)).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.ctors.dtors.rodata.rodata1.got.dynamic.plt.data.data1.bss.symtab.strtab.stab.index.comment.stab.shstrtab.stab.indexstr.stabstr  00DD< )DD 3IXIX9TTX?άά EθθLS[dd00i44r w֠֠Z}1$1$l11F1G?