ELF4Ȱ4 (444  TTT0Q0Q^  Pȍ_  hhhDDPtdl!l l 55QtdRtd^  /lib/ld-linux.so.2GNUGNU"%>xeR%"ƶ  8h@@A@ !@`@‹if@H@  P` -@c #@0-B$Dfq(@B  Q/A"PN0(Bh d@ % $AXB $@B@@ JPP !  H0 P #$ 8@8I1@5` M 8€,$@(@D`@0 0Fq "P2H s@!V J H` )C@ @ \ hB 0DP 42H08!@@P @HRX2 @"@%@@bB H@R@ pA! m@#I #FG J  4R`A",: @B! !0F` UA1f BUTA@ PR+" nB" ppB$B @@   . D@@$ q k Aa'@($ h@!"('B@ DH` @0@ ;CQ`D"P@ HX+@P  P*1$ S(pRAXpDD 9!$ H (Q"@@ h2hLPA J  P"(@ Cu ABD! $@F#!&2L@) dBR  J* &A (B! c@!HIF !@Ck@$EH" P @D iN$`IT%P(TD$@ h2"I0" $@90B Habv"Bh D!\!4("  `r3@&" I(0@@ @aIxpB@P$a$H D!   HR "MR`J@ 0D @!6 L J'  !@86 I@ (5JE0AdD!(l@2BEPB @ HP@"@` b@T)b1T#H50D PI4dӠ%( $` h4 0 @ CQ@$&2Ae*"D@ i  $* XA@@0 ]p$ !@J$AH1H B $ B90f !"&*+-/139:<>BCEGIJKNRSVWXZ]^adfhlmopsvwx{~   !$%)*./368:=?@BDGLMPSXY[]`acdghklmopqstuwx{|}~   #&(+,0359;=?@CEGKMNPQRSUVWY[\^_adfijlmoqtvy}    !$%')+,.124679:<>@EGIKLPRUVX[^abcglnoqsuvz{~   !"&'*-0127:?ADGJLMNPRVXYZ[\^_`acehjlmqvwz{    !#%),./0236:<>ACEKOVXY]^_`cdfgimnoqrtwx|~   #$')*,-125689:<=?@DFGIKLOQSUY\^`bdfknsuvxz~>Ӏp2ޏ!,-~sX`5s]I5>/gE)F YPEU\Ź@hyY7 X6/WXfGA6 #ej|)L\;%qPjdojVk$fd-Kgd+HP;:=̜;yeEʍ>aˬ@ۈ*-2<4Z@A#h{ʶZH 9ո*9ED̍V oQ9)f8gp uWIO>~@0 /,کV(}"ӁVo]2(Gǽ#@o.9Qd;ާm -efla}66d6g>QH:xo8x}o߲>$n2GyOZqQ>,`Y;Ees@AH8Lof8>Q:H;Zhw)RiO>rcozP۩o2r*~"&˜`![Ȑ[ 3V[ R@+4 .ūNh,f;4{+X샛@IQ(ɶSFXkUdTH,LA|MǣS}C?a Lp-ybTj)2^d'YuRKE{tC\gZ9/0#oA)). "lS6!cDv*ڗ٦[Hzќ9q(Bz;K>nbEyM8qm^4BEf xcѼCB@#4;~b3߉rٴ;kЏ?@>eXW\{^!˱W]o;:ƻJ#i໇;DӮod tG`0CC;c9xLCuXNsaHF! FX`ȴX;)Uږ?]mM> b<,E\خnb(`G$ : D;{/#8a/K lY/ t:DXI/*GVZgYo_qw9G0#!+-RL{L9Nk9Bt;Bw4+zWP\+*!7Sb֖ԋvu!t:bn(jy$&-:GbS;czk`cm 4ԝv2"6SKtm^N&}$Q%|->>,<'ǝ__ͱ#%Hp"=d B'aϋ`lRV%\J8!K>{5! EZpv+VoT2C EY|*8ػiGja3$Y z`og=d} +0BOJ}<*\CPhgg;sg.=孕_Oe8;qm+޴`YA?yȚwg#×d`5E|?%'OG. H KaN3hv,QIfǒ#Ed0EO%P%&eQx%ܔȆm\.bߎοl& tei+FO֟ZlV,~sIA7z%KDYY*/, UB08gg Rz YOJ3טRlmu.#jۭEgwHo QX @_˽"$g`.M!s.Fv=tX7X]{E\{b&nafEoD1ȮBu 4y"Q}p6hE&:m)AR~kJ3&x&[TTR Z%݆VnT^cVUU aEfҷR_y.۵_q$\ܿjd.(j7#Uar 26t²5JT ['N`oA"5.D'p=cVN~sq qڰ"axH,<3*qX|ߢGf~ӏOj0>M}v~abNTdwΣ\WOu(*2:xo-9L?pߥЇ9*źsGq@C__PD[-(/d¿qtYLaYG`1e"m81:R_#SeOy}NI )"l]fbv$X& ؊z@I,qm8+A!sTnWwR>@4ѕۮoPV:5n݇k20]m Pt|H8TriIkg4H{)v1}A3nNQ "d_,M0C5â,4A&-Sx=; KXSt/kf8|X3f8X8"`oн,DLd ?|j X>QeK^-G [>[:)^PB|N&ayac@)x2,\5=k(m+,R^5 B_D.kVH?BSKB,XY[4:#BڭahT(ځ y3 3E2b莃eCgd|oo&+' i$quᛪv{~-.HW_!?9%mZVԯ3bg d|A+_R~Q8^ͬ:</%߯o满ņ+m4;Ыe,Ck4v*$/E6-.(a~>+K?xc /K/b) SFrXeδk&)?4{U^1cZZU,6q82#>= oB튊uY܍ϫG .kcG $n`/G G TɔG G zۑ'%&tG ~G k٬l$JR|gEuK݈q礨#Tk!%dž-;ӪPbV& (Jq\+ϻ.~Ho'os: 1{eBS`3i;e=M*'ubu:ĉe'LWo)0x¿6#04yxou9J@|"Lܠ8"^0mOܠl{y Al)GW fȌg)f8^hV}ejޝXySV緘:^<~pʅN$A^wr/?1Q[/bLJކDZEk26L[pnjSOA8~^ 1hhUF.8>;ݣk^M]ej6<(ID1l9Tѕ._{ @Ə!o;ƚ"97hɼ'M,:fM9/W4,}c I/,W s҉1eF8pu. HVDBֹC%c.KEk{n"N(]mEA96tO~e%0~]"_*NL_JkuNaU7@ *&cQeX H/"07qWPxas+,nS 5l1&cnvRs2վ`FT\gAfA뢯 $ͷ^QT{:~S%GRIz'ʹ}@ f .~.0 :#h;#ЂQ:BNHSa0n6L7JJRĢvIW6q3]K} uj)? (5zRæ RZg'9+>s{ iv;3{P 6oȒgǁ ;wwB' "/H$2\U PfϵH7$K$ (9!cITajxŵFxżJkbCѮBMkT2E{[WZh@dy)LkaLmrȁ5&V' JҪFf f˳ZW5>b)Rn d`#e]Ng(L| m.ExP*:Ds7tSY*y| ,&eWt0seWtgWtv l6.{#v6dk8^ṇSP`AVEd/ԅxXQw%ԋ^ ItD-IclꞖ ^Y|͓s19I!⏪S Aq[oq%Er@65>iqdg\iItxgӔ8A3%#i1s, Kd4]nABpYJlf}C^?JЬ 04,s gxiқ`Q-(kY*lΌ=NUDǂP#K &BCsVI1&m@NxM%z񌔬G1-WnB !DBHOr{6JoA,X$Ul'+e>-l M.Ƌ7Z`_E'B qghvlh MHja#aB>J'I\4n HM.WA҇ Uuў:p\P{0{ȳ5-1@̣ayFeYU<5z-Ht4BoG;L8.^VCuŌ#wP}5qZDʋ8f d}-etq nFXVCnTdڴղOVwv Nra)&lP2?݋q贪ΟcDP49 ev+y36);jۇ}wNWo,qT_>*'Y( of8ǃ*|qf8 w;/=NxC`c†fTC0;q6 $#)f XHK:oA2ElpW٢WiXm}csH +VG ~5o$ $ A&'MsU辏}}y)<FN 30lPN@&EdzT Y @5zmPBᅤHyI=_wonwۭ &Ct] XNK?f@%/YzN 3dvP sY!l|ϓ<4d ynv4ź{MzcM_NOԇ l@qis 54 w|ftaF VIC,IޱhAJxpb-ѯ2W(==ON<9-# GJʐ}ۂ5+z{Ţ1e>(J1¤SO{q(/0zFVTC@Pi6Tà!K n; bi202nB_ 4ck'26o;zY˧;igGCx -9߀0$A@j Cd35i7w|sl=lmRMsXu6"4B_)0Kݴ6Hi_ҘvMofTʎ$ ⣧("+(4:攭Йu* |AsӔ 6R&hCs<:=6NB;Е`wM w`<%X01迉+ K`#Vf3_Dͻ(UC64~o2$JCtYMlO>(7arS94KJfD.hg'[_8L=dfXe(d>d0|"|CBvTBv B,t.IH}v{8\੼Dѳ~A$Nm 1{nT|E)F3dn:|o=;?lc?s97:)l#L 0,Xl!(5IHO<c0D`R,F lSD |z7 i\-Y2E .` 0?vÄ>5tA7ZtL] vyK68n1Bk$M!mx #3CLg- t%O/y"hbԈeO L _ V g 09 )/ $ @]1  %' Q z*Pn' W G s2@T   ` + cC{ $s I 0 a 7  Z4 Q m0', 0 >  sh p  qpe  \А k =ay : CU  X  0* ` wo  { ;(Y  2  a=^  oPn ' *w& w!4 zmp0  | | x| Ё= ?W |A D ~j$ E >q  p3  UXo> l  l= < vM@ T )_ ` L@  ~[ ` Ue #d 1  p1p [  CH  b ! d H E )z T0A  gJl5 P 2? -  *C Q  0[ !p3 f"  e}0 PV C !% "p     k8  Vud + eX` s x v | .aIp !  @( J 8}R m=  < t ; < RP~  %T c ) s0q ` S Y0  rM  (~`d8 :d9 Y! 3 qPz  %p1) ~d9 F C 0  }p 6 j% F cP Z zG@.     p K  W   7A  3\/ Hs] `X fbt a pj| d ' 9 *H` A gZ" lO  'pXN *Z e`2S !& J u`&  U5K W@m :g 1 dh  `~J r{ ;  c8  ` I B UP np P`7 -"  @0  rBPr , w@\  !# v,D {| 94Ц  y$ _t ) -|p l }o ) 8 `| +m O 9K@W  v'o  k TH 1 W@ p m0u H   fq# /8 | "DP ~K w  4 @  wk ~  (Ri ``7 p  +M @  { /R`  u% E &g h  ,\ Vb@&  +  0 F7 = M p npq \  Xc   X| 0/   0U e\| ZO D|0 E M( X dV  : F 63  h C   LK ,  q{ :D{ W E !C "x@r ~z1 ^ *^v & EU O 5 #O  =02' @ 0 $  WaP  eP h `9   y@? %J y+ b B)0 kF 4-P}> 1 1@g 1 I~P^   Mi  >{ ] wcL "lr % x # k" L m | /pG O 6;Z ˃*  Pi bLj   ]*   I  |&е #1|   lp9  -G @  9l :p J= n (M  =M`  DJF (`  m I N  a  ; n - _BP^ X/ S , & x  x  JF| Q` >=  P0` [g|  e "5 (8 U j@-` B 4  :0 k `*0  Q   T V'  #z  I+* * H` Pj0 "! : x} 3 : * * u ! N  Q4p* Y<| i  PT ( 9 -  av < ։ K @- L ?@V' /@h N CC< /]u  at < Nn04 v 2 T J9 e 6~q C 2`J M  0 b`m  DpP| axp )FP`V P ) @@/   _ L  S 3 lgЄ ( F y V fld  op P S w  9 1x a 5s  o\2 Ċp=W _ Psu J/0 r>|  < I e &S(  N  #p4H +=  %  Q0S* tf 1 b9pY Z ?@r : G = ]P 7p&, Id  >*`v  lF | V` PiU  ?uЌt  H  q  `/] \  zs ~ %C9 >P5 ^Hp# E   w?  7| ] " !  = }c Uh n@O  T`  $$"W yU!E z` ) `d Bp( # | TPJ    &R =& M  >,2 e /pf j # WL :%R  A i      1( I qP 3 @S x" <  c . s 4  UNp |h   =`Z 4p q+ e p b\  c,` ( u`k 1 9Z  T| plZ 3  m J g   '#x  lmr (pQ [8@! : E; F {` m} 5 Jm P[ 1z : p, 9? 0m^  t| 3   g6'6 J<`,  L0  Xl _[ _P 1 ={? u@`3 e L@c b 0=  H1 Qh 1 p J l`  (+ #= D 01   g " HG }{`59 H7pG RO V{ cM E u < Ep1 < LT( I- '! Np: I p S #  ? F = .P= p` = AO@ `@? ? &; x Xw LC 0c k]@ 1p S  o}> x  S  3  IV # v /nP  p  pw  f Jhx  =y .  c  Pd  i%W r W cp'  R% .10 vW  DI`w : k.  =Н [ AZ  0  })P9 Wp| e. 4p<  Pc  SO "@> ` 46  1p4 k 2 0Z 6 hC u} # $ Fs< gT + S\@  Q2| Ib4  XPD )K  KP7 $} w%l {  z| 2  LY 5 lpPc J, `/ c 'P ) gP p 'Tr ) gZ   @&, O}F 9@  R?oe S`v .@ ? E  E 3 n@^   pbP  N )  ![ 9g # +` t0 ) ^<-  %; x jЎv H  #;w @ FR  ^T 5| ]b : vT =0A eQPA & 2U"8 _  \&0 Z}V [  ( oC  =pF 6= UP 3 OЁ" }  Ƈ`R Ee b / > sP = 2 P 8  s=F Sp jp@ U  hfK$ n70 - ag 1 `. ? |@   0  o4^ J ( |f  -Yp  0` \ =i@| G=  U` S t  Ql h w };&  C6 rp7 :@A w= , c h )` < N  `k4 tk  Bw  F ` @ ςP< It. w`^  |p Q@kr k: O S ]P  8{  +X`$ a~0) I B  jpml _Oe ! ;t, ` i` L"@\  ;   .} 4  Lg@ ei,  #p6  K , Cu Tw   , bP6  @{ (0 _ 8p  + < f | {q 9 ; r ( Xv  p@@  W]J " , ]V  V$ N' J h0 /+ mc&4 0_ L %  j xk 2 > g y$@w  Vp> 1 O/  1  @@ \` 9 m< => Y)0#A )IP/ S P(  i.` ; 3@ P _@  z60p )? !G z IC  R 3( n < *z| h0P1  4 )p4  .4` B  <d f1 {Q/ xE :O xi F ~+O @/c 1 <  s@T D G ځG %  ? 7#P>  = % 8'5 ud b ~B T  k < 64 LQ. @e 1 7 9 5h 1 o5 J [h| ڈ  y0(  | tI n C "&, ,T A ( [   e9 U Џ  w'9 *? !8T rKM 4x u  ;6A a f k0c, Qmp]' d \ `T G +_  %0 % ]R4|  J # t ppd AF S  3* o w I  3 [08  /`,  X h 5| d40-  F np=  H 5{ D "UP a zW / o # #C +u " H 9Wm 1o !G R{  @ 7@z  @ 5! (bV t `B  ?#| \P  )&p < a!Pf  U`  ks  # E ]3 r `0 C -@  yR` lt3p4 ?Jpn* MT  T jI  vj =А  _ ( a@p  C0X XPp  lT u  @h ru t up ( J pI d+T 8\@ M T6 !  L0 g GL0 # dy z@w e-@4 7c  .Gt  9r04 ZV `6 c$ $W b i .1 < K(  fp4 0x  P. s3 0w 1 -3 .{ r'k %` VJpa M 4/u >`U  3LR  WP*V @z` @ R G Ѝu X{ B  g   er  )t F$| ?`P * {`P <`> G a 260G# b6J4 9f`  5P hA@ kRU } Z~ B[  u@,  ?!T  <p6 R`G [0   0  G  S$ E Z\  6 E EPnO _F5I H}6 kW@" < ^F lH 4? M @ g  z '~{ E   T- 69 X& }l# L 6E ?:`Q  G7 U n? U8 ? hl 5 , n [4 N ^{  &1  U  ; z 1Av i ` epLz q { e@    #6`eA zeA u | r'? ",`@ v 6 P9`> u  P* Q %  ȄP+ A0  \;  SH{  NB  ._e 1 h0 < =y  q  K6 H } ` z0, M p օOu k)  ) oЄ % 4 ^ &  :P^ 3  3 Mp' Y\ - i ` L VC  ,p< qPu `Z П> ^Y ?_PP [AF+ J@v  Sd cd@ < u  } B  @BX R& ( u0, K9d P  )t ?` sS  + v 1 00 yDP8 U _Ep  {J< YG *^ / Q 8 ~p j  m EO FU  {p ' z  E  P' Z R[@ H @^ BP D 7d) C e  q   Q] }  |F B7 W[= R`@  @ F 6 Xj jH| b P 2cd  IТ  X1  ׀'  a`] H  MN I  S6 +0 E < H`} , / J 2  Oi CCdV  5 } #P' K (W@*  B =  x p` A 3 ^ P" &(} K-0A [ gN| gwm *PtN r02 EG`L " `p$  $D `P= X (> B eA l`# 2 0>  i` Z `1 s0 {0  <>0 C   $06  ۉx    -0OM ~v-  &P  *  P/ f Z R = W' A?| _ }  C  N 9 P  r~  5 km 6@ /Z 7 O  Y!. z]@y  E J& K  f@# (  $ E 1  0| [  [s+  sa R y  '  k`w y.  1! ? 8   |yP  YQ th& > } 7 ^   ~ ^ ? a`$ u, ;f  R(  A1P W|ж, %Pd ?xg ',  N  1P=  `W  `} _ *!& IPA ~ 5  D9 !f # 0#   $9" 6q` ! t@lK _|| S0# B  )D+ I} _j - X  > V  d0p>  ) 3 Z^ $f 1 " < 0b O _@ P0= Z_`  0K " q=[ }f P P Of ^ L 40 X tT n  N@1 # )i  g?' K Jti i&$ `Z I! a oЃ  6{ /p 1 M,| hOXM (J`rH i  0m 0 W ) 8 4+ 0F . -*0 ]< h   , Ms@! J $  #d`}  †P = /EpB + zH g }@ < .К 3 f1 lzB Y  Ug 1 00  v ` !@y m + 9  2p* DR @, qT| TUh Ak 98  BA| Z$st IPq f[< {  , a{ 9j&  [`O  d0   Vx P 3 ?. > IZPP & 2, %@3 kn  [@ zX 02 @ -`H ,  AP 3 }1 ׆0 - q? Dy  P% E <$pO   Q0 V d _" }    Z  \  gJ Q  vEe 1 5 ypN  _D b2  Xp\ L1 &0Q 67 ]I`l x b^P \ K  np Z 5 fU  q2q 7@# < m4 != |s |-< p  G@_ .  ` d) o i` ' T>< ه  *  d)Q ( @  QC :? k9 Yf 1 8l(Z 9.  ?d| 6` 2 O!pU e#w 5p E )$ L htN [lL| |N  k  )?  & ) , ` y> 8 F&, T@; U#= F   L | { N; ^a d j'  + Z  M  hop. pK  5 l #5v   Z7( + ~`% # =@h 1 < ! @w \ ) @ VJ c< * 9I k:] 6 HpA Z#@, M W0} 4C5y .М 3 Y`6  `=  Pv o3`< i<Pn I S  J0Ќ 1 { } @' < P^m 5 iPx $ N"G `P 3 fH Ooo  4pt   j`{ $9Xu # ^ >@T U K s%  0. +4 (J :  `v V Dv  | e{ y   s  Ѝ  ' ) ,h^  pp ` v^: I ikP4 20 o *NP 3 r8| 0~   g{  V Fp2 w oP$ /%PX8 =|  ]0!H 0 3 lT  WG  &: ~J  h07 N l = /u9 $  j;W NP < fY`> ad 9!   L  qa l 63 7i  @ -B 3 *`$ E 7A ! MD S `G ?nA  F L&, xO0| _x  S.02 /x  800 libdl.so.2__gmon_start___Jv_RegisterClassesdlopendlsymdlclosedlerrortputstparmlibtinfo.so.5UPtgetnumBCtgetstrtgetentPCtgetflagtgotolibm.so.6feraiseexceptmodffedisableexceptfegetexceptfeenableexceptfesetenvfesetroundfegetexceptflagldexpfesetexceptflagfrexpfmodfeholdexceptfeclearexceptfegetroundpowfetestexceptfegetenvfeupdateenvlibc.so.6_IO_stdin_usedfflushstrcpysigsuspend_IO_putcstrncmpposix_openpt__longjmp_chkre_matchtcdrainsync_file_rangeconnectftruncate64getpwuidmmap64closedirgetgrgidstrncpysigprocmasksigfillsetntp_adjtime__stack_chk_failunlinklistenmkdirfsyncgetpidchmodgmtimestrtolisattysymlinkcfsetispeedfgetcfdatasyncgetpwnamstrlensetitimersigemptysetcfgetospeedrmdir__errno_locationtcsetattrchdirmemcmpgetpagesizegetsockoptgrantptdup2__fxstat64shutdown_setjmpptsname__fprintf_chksigaddsetctimestdoutgethostbyaddrfputcfputsmemcpytcsetpgrpstrtoulsetsockoptsetpgidgetgidre_max_failures__lxstat64opendir__xstat64__ctype_b_locsscanf_obstack_allocated_pgetservbynamestderrioctlmunmap_obstack_newchunkgethostbyname__snprintf_chkdupgetlogingetuidreadlinkfscanfexecvegetegidposix_madvisegethostnamegetcwdfwritefreadgettimeofdaysigactiongeteuidtcflushwaitpidunlockptlocaltimelseek64utimevfork__vfprintf_chkmktimereaddir64statfs64tcgetattr__ctype_toupper_loc__strcpy_chksetsidfcntl__sprintf_chkcfsetospeedcfgetispeedmemmovefopen64ctermid_obstack_beginstrerrortcgetpgrp__libc_start_mainppollsysconf_obstack_free__environ_edata__bss_startrenumber_primitivePrim_process_tableoption_library_pathOS_file_truncateOS_ctty_set_int_charserror_system_callPrim_heap_available_pPrim_os_job_control_pPrim_find_next_char_in_settree_error_noisegc_handle_linkage_section__libc_csu_finiPrim_float_environmentPrim_stack_address_offsetasm_generic_subtractinterpreter_applicable_pOS_signal_tstp_handlerPrim_float_rounding_modescondition_restart_findPrim_initialize_C_compiled_blockPrim_set_working_dir_pathnameoption_batch_modePrim_write_word_to_memoryPrim_integer_subtract_1gc_precheck_fromPrim_tty_command_beepPrim_channel_readcomp_unassigned_p_trap_restartPrim_with_history_disabledOS_file_accessOS_open_output_filePrim_bit_string_movec_xOS_initializePrim_get_float_rounding_modeDebug_PrintPrim_local_assignmentOS_save_external_statearg_ulong_index_integerPrim_flonum_normalizestrcmp_ciTerm_NamesPrim_equal_fixnumPrim_recordcstack_pushPrim_scan_forward_to_wordPrim_enable_interruptsPrim_binary_fasloadsyntax_code_specPrim_create_tcp_server_socketPrim_get_host_namePrim_pty_master_send_signalOS_NameOS_process_reasonPrim_re_match_bufferOS_open_load_filecallback_lunsealoption_emacs_subprocessget_trap_kindOS_restore_internal_statePrim_integer_bitwise_andc2sighnd_console_resizesighnd_renice_wrapperPrim_set_string_lengthPrim_nanotime_since_utc_epochRESTORE_CONT_RETURN_MESSAGEgc_vectorread_uuo_frame_sizePrim_lexical_referencePrim_gcd_fixnumPrim_float_underflow_exceptionuintmax_to_bignumexecute_reload_cleanupsPrim_local_referenceoutf_flush_errorPrim_with_interrupt_maskmmap_heap_mallocPrim_flonum_truncatestore_trampoline_insnscompiler_new_subproblemPrim_peek_cstringparg_symbolset_ulong_registerasm_serialize_cachePrim_utility_index_to_nameUX_initialize_signalsmake_microcode_identification_vectorgc_space_neededPrim_file_length_newPrim_new_directory_read_matchPrim_get_primitive_nameasm_generic_lessPrim_run_callbackasm_generic_addPrim_fixnum_andcPrim_process_jc_statusarg_doublesighnd_hardware_trapinterface_to_schemeStatic_Primitive_Procedure_TablePrim_peek_longPrim_match_forwardPrim_vec_8b_find_prev_charOS_process_any_status_changePrim_integer_nonnegative_one_bitsUX_ctty_save_internal_statePrim_encode_timePrim_primitive_purifyOS_process_statusPrim_terminal_set_ospeedOS_process_interruptOS_process_deallocateOS_open_unix_stream_socketPrim_system_call_error_messageexport_renumbered_primitivesia32_cpuid_supportedload_renumber_tablegc_handle_pairwrite_to_fasl_filesighnd_interactivePrim_gc_space_statusOS_pty_master_continueunspecificPrim_vec_8b_find_next_charUX_out_of_files_psse_read_mxcsroption_fasl_filetermination_eofarg_index_integer_to_intmaxPrim_band_dumpPrim_get_primitive_addresserror_bad_range_argPrim_scheme_program_nameOS_terminal_get_statesighnd_interactive_wrappergc_type_mapoption_unused_argcPrim_termcap_goto_stringget_interrupt_maskPrim_vec_8b_find_next_char_ciPrim_poke_ulongOS_ctty_interrupt_controlread_tospaceOS_terminal_cooked_output_pPrim_flonum_tanPrim_bit_string_allocateOS_channel_table_sizeStatic_Primitive_Arity_Tableset_interrupt_maskPrim_bignum_less_pPrim_vector_pasm_sc_applyPrim_new_file_open_io_channelPrim_float_divide_by_zero_exceptioninitialize_interruptable_extentPrim_alloc_selreggc_no_cc_supportPrim_current_user_home_directoryptrvec_allocatePrim_sys_pair_cdrsignal_interrupt_from_primitivePrim_bit_string_or_xPrim_integer_divideOS_tty_next_interrupt_charOS_process_table_sizesearch_path_for_filebignum_bitwise_iorOS_process_killwithin_c_stack_restorePrim_have_ptys_pconstant_endPrim_object_type_pcompiler_processor_typePrim_peek_cstringp_bangPrim_greater_fixnumPrim_trappable_float_exceptionsPrim_substring_downcasePrim_get_environment_variableOS_channel_readPrim_flonum_ceiling_to_exactPrim_file_eq_pgc_handle_ephemeronUX_ctty_save_external_statesystem_pair_consC_Frame_Pointerunpack_control_pointPrim_bignum_multiplyPrim_zeroephemeron_countcomp_link_caches_restartarg_integerPrim_primitive_procedure_docasm_nofp_equalintern_symbolPrim_flonum_sqrtUX_prim_check_fd_errnoOS_file_link_softbignum_bitwise_norPrim_tty_input_channelPrim_integer_first_set_bitPrim_dld_load_fileOS_process_idPrim_stack_top_addressbignum_bitwise_notStatic_Primitive_Count_TablePrim_pty_master_continueOS_file_removeOS_ctty_disabled_charPrim_peek_pointerPrim_current_user_nameRe_Enter_Interpretercompiled_closure_objectsPrim_sys_pairUX_ctty_restore_external_stateOS_deallocate_select_registryPrim_prim_make_objstruct_to_scmPrim_terminal_get_ospeedPrim_multiply_fixnumasm_nofp_negativePrim_restartable_exitPrim_cast_ieee754_single_to_integerPrim_channel_descriptorPrim_pty_master_quitStatic_Primitive_Name_TablePrim_integer_lengthPrim_fixnum_orPrint_Primitivesighnd_dead_subprocess_wrapperOS_ctty_get_int_char_handlerssighnd_console_resize_wrapperPrim_object_gc_typePrim_pty_master_interruptPrim_flonum_expOS_signal_int_handleroutf_flush_consoleexit_interruption_extentPrim_set_interrupt_enablesarg_extended_stringUX_read_file_statusPrim_char_poption_saved_argcPrim_positivePrim_get_user_home_directoryapply_compiled_procedureinit_exit_schemebignum_shift_lefttrampoline_entry_sizeOS_open_exclusive_output_filePrim_file_set_positioncomutil_primitive_applyOS_get_host_nameread_uuo_target_no_relocerror_unimplemented_primitiveOS_malloc_initOS_channel_synchronizebignum_bitwise_orc1Prim_prim_obj_addressPrim_channel_tablePrim_flonum_logarg_alienPrim_file_type_indirectscheme_in_foregroundOS_make_subprocessasm_generic_equalINSTALL_HANDLERscratch_obstackmemory_block_endPrim_hunk3_consUX_initialize_cttyPrim_index_fixnum_putility_tablePrim_char_ascii_pPrim_scheme_environmentOS_tty_input_channelstart_operator_relocationasm_primitive_errorPrim_under_emacs_pPrim_floating_vector_lengthcompiled_closure_countPrim_return_to_ccallback_run_kernelOS_directory_openPrim_flonum_to_bignumwrite_variable_cachePrim_bit_string_refvoutf_fatalterminal_state_bufferedbignum_make_zerooption_disable_core_dumpPrim_UX_make_subprocessPrim_inexistentPrim_re_search_substr_forwardPrim_vector_consPrim_record_pgc_raw_address_to_objectPrim_poke_longsighnd_software_trapinitialize_interrupt_mask_vectortype_namesRESTORE_CONT_EXPR_MESSAGEprimitive_table_export_lengthPrim_sys_subvector_to_listPrim_vec_8b_refOS_file_link_hardPrim_bignum_subtractx87_trap_exceptionsbignum_bitwise_xorcomutil_operator_4_0_trapcomutil_unassigned_p_trapcompiler_var_errorvoutf_errorPrim_process_continue_foregroundPrim_host_address_anyPrim_get_unused_command_linecondition_handler_bindOS_process_send_signalPrim_dealloc_selregPrim_flonum_truncate_to_exactcomutil_quotientPrim_re_search_buffer_forwardasm_primitive_lexpr_applyFree_primitiveread_command_line_optionssse_write_mxcsrcontrol_point_endOS_file_type_indirectPrim_set_cell_contentsPrim_poke_uchargc_precheck_from_no_transportfaslhdr_utilities_endPrim_flonum_asinarg_nonnegative_integeradd_reload_cleanupPrim_peek_ushortdstack_set_positionoption_force_interactivecompiler_interrupt_commonOS_open_tcp_stream_socketPrim_positive_fixnumPrim_integer_less_pgc_handle_cellPrim_integer_bitwise_orc1Prim_termcap_get_stringPrim_non_restartable_exitrequest_timer_interruptsoft_resetOS_channel_typecomutil_return_to_interpreterPrim_outf_errorPrim_flonum_negatePrim_set_file_modescomutil_zeroOS_ctty_set_interrupt_enablesPrim_sys_list_to_vectorOS_make_pipePrim_poke_ushortbignum_make_onePrim_sys_vec_seterror_out_of_channelsPrim_flonum_denormalizeOS_ctty_get_interrupt_enablesPrim_set_string_maximum_lengthcc_block_environmenttermination_no_error_handlerarg_ulong_integercallback_returncomutil_moduloOS_have_ptys_pPrim_make_subprocessflovec_refdstack_resettermination_init_errorPrim_forceguarantee_interp_returnclose_fasl_output_filePrim_error_procedurebignum_first_set_bitsighnd_dead_subprocessOS_open_pty_masterincrement_tospace_ptrimport_primitive_tableinitialize_gc_tablePrim_char_to_asciiPrim_scan_word_backwardPrim_process_hangupUX_ctty_restore_internal_stateguarantee_extra_ephemeron_spacePrim_read_byte_from_memoryPrim_floating_vector_consPrim_set_trapped_float_exceptionsPrim_real_gidread_uuo_symbolPrim_trap_float_exceptionssighnd_control_x_wrapperterminal_state_rawtermination_end_of_computationPrim_find_prev_char_in_setclear_bit_stringre_search_backwardOS_get_service_by_namePrim_match_backwardbignum_bitwise_andc2Prim_get_primitive_countsPrim_file_removeOS_set_trap_statePrim_file_acc_timePrim_unbind_variableOS_real_timer_setPrim_bkpt_proceedOS_ctty_quit_charcc_entry_to_block_addressPrim_catchPrim_file_time_to_stringallocate_bit_stringReturn_NamesPrim_re_char_set_adjoinbignum_to_doublePrim_debugging_printerOS_file_directory_padd_to_tospacePrim_integer_pgc_handle_broken_heartptrvec_move_rightasm_nofp_subtractPrint_Expressionabort_to_cfinite_flonum_pPrim_plus_fixnumenter_interruption_extentPrim_real_timer_clearPrim_lesscomutil_operator_lexpr_trapPrint_One_Continuation_Frameread_fasl_headerOS_channel_open_pPrim_file_touchPrim_substring_move_rightbignum_bit_countPrim_bignum_quotientDo_Micro_ErrorPrim_terminal_nonbufferedPrim_string_refptrvec_deallocatePrim_rehashOS_error_code_to_syserrflovec_lengthOS_get_host_by_addressPrim_set_debug_flagsPrim_host_address_loopbackPrim_sys_vector_refvoutfPrim_flonum_integer_pset_ptr_registererror_external_returnPrim_file_accessasm_nofp_incrementPrim_bit_string_equal_pcomp_interrupt_restartPrim_file_link_softPrim_reload_retrieve_stringPrim_hostnamelookup_external_stringUX_reset_terminalsinteger_to_uintmax_pOS_signal_set_interrupt_handlersPrim_verify_heapPrim_floating_vector_refOS_channel_copyPrim_new_make_pipePrim_flonum_multiplybignum_to_ulongasm_generic_decrementPrim_bignum_negative_pcomutil_operator_4_3_trapPrim_scan_list_forwardPrim_file_open_exclusive_output_channelPrim_subtractPrim_record_refliarc_object_file_prefixPrim_poke_uintOS_reallocOS_baud_rate_to_indexbkpt_installrequest_console_resize_interruptterminal_state_get_ispeedcheck_fasl_cc_versioni386_reset_hooktty_set_next_interrupt_charPrim_unbound_testPrim_file_renamePrim_systemwrite_tospacePrim_process_idgc_handle_undefinedsighnd_control_bPrim_file_type_directexport_primitive_tablePrim_substring_upcasegc_no_transport_wordsPrim_record_setPrim_string_lengthPrim_c_mallocPrim_peek_cstring_bangPrim_cell_contentsasm_interrupt_closurePrim_fixnum_negatePrim_map_code_to_addressOS_restartable_exitasm_primitive_applyarg_to_channelPrim_fixnum_remainderPrim_comp_code_address_offsetPrim_current_gidasm_fixnum_shiftPrim_fixnum_notterminal_state_cooked_outputOS_test_select_descriptorsighnd_control_xC_Stack_PointerPrim_current_pidsse_presencePrim_flonum_modulobignum_max_digit_stream_radixPrim_flonum_addplausible_cc_block_pRegistersPrim_zero_fixnum_passign_variablePrim_peek_charsighnd_timerPrim_poke_floatdecode_old_style_format_wordOS_channel_write_dump_filecheck_number_of_argsPrim_dividevariable_unbound_pPrim_termcap_initializePrim_quotientscheme_jc_statusasm_nofp_greaterOS_nanotime_since_utc_epochOS_process_status_syncUX_reinitialize_ttygc_scan_oldspaceterminal_state_set_ospeedOS_open_io_fileia32_cpuid_neededPrim_get_service_by_namePrim_channel_blockingPrim_float_invalid_operation_exceptionPrim_install_bkptPrim_integer_zero_pptrvec_copybignum_hamming_distancePrim_write_float_to_memoryPrim_read_float_from_memoryasm_errorwrite_cc_entry_typecompiled_closure_entry_to_targetOS_job_control_pstd_gc_pt1Prim_scan_sexps_forwardPrim_quoted_char_pcstack_topPrim_with_stack_markerchar_descriptioncomutil_operator_3_2_trapOS_host_address_lengthpointer_valuedigit_stream_to_bignumcompiler_cache_global_operatorOS_terminal_get_ispeedlinkage_section_typechar_pointer_to_string_no_gcPrim_lengthPrim_real_uidPrim_termcap_get_numberstack_endcomutil_errorPrim_invoke_C_thunkPrim_flonum_expm1Prim_shutdown_socketOS_pty_master_hangupPrim_divide_fixnumOS_process_quitdouble_to_fixnumPrim_sh3_set_1Prim_addcomutil_primitive_errorfixnum_to_longPrim_re_compile_fastmapsafe_lookup_variableOS_pty_master_interrupttree_lookupPrim_profile_timer_setcritical_section_hook_ptermination_signalPrim_flonum_acosPrim_directory_deleteencode_old_style_format_wordOS_file_renamearg_real_in_rangePrim_increment_freePrim_gid_to_stringUX_closefromcomutil_compiled_code_bkptPrim_peek_doublecomutil_interrupt_ic_proceduregc_handle_tripleUX_SC_CLK_TCKOS_ctty_int_charcondition_restart_bindPrim_canonical_host_nameError_Namesreal_number_to_doublePrim_peek_ucharasm_trampoline_to_interfacePrim_fixnum_quotientasm_interrupt_procedureskip_compiled_closure_paddingOS_have_select_pPrim_integer_subtractOS_ctty_tstp_charBack_TracePrim_multiplyinstall_primitivePrim_flonum_subtractPrim_integer_remainderOS_profile_timer_clearuserio_read_charasm_nofp_moduloPrim_poke_charx87_read_control_wordasm_dont_serialize_cacheOS_process_continuable_pasm_generic_negativeasm_sc_apply_size_2Prim_bit_string_pPrim_flonum_dividereturn_to_compiled_codeasm_sc_apply_size_4OS_current_user_home_directoryPrim_sys_h3_1terminal_state_get_ospeedtransaction_commitasm_sc_apply_size_6comutil_lessOS_test_select_registryPrim_sys_set_cdrPrim_process_deletecc_entry_closure_psearch_for_library_filePrim_lexical_reference_typedouble_is_finite_pPrim_tty_get_interrupt_enablesOS_directory_deletePrim_substring_lessclose_fasl_input_fileasm_interrupt_continuationPrim_listify_bignumPrim_write_bits_xOS_process_status_sync_allasm_sc_apply_size_8newspace_to_tospacecstack_popOS_file_touchcomutil_interrupt_continuationrequest_suspend_interruptPrim_flonum_positive_pupdate_weak_pointersPrim_less_fixnumPrim_bit_string_zero_pflovec_loctospace_available_parg_terminalasm_nofp_lessbkpt_removeOS_terminal_buffered_pOS_open_fdStatic_Primitive_Documentation_TableOS_channel_nonblockingcomutil_decrementPrim_vec_8b_setPrim_bignum_remainderobstack_chunk_allocbignum_to_integercontrol_point_startmake_uuo_linkPrim_process_reasonPrim_notPrim_remainderPrim_file_open_append_channelcompiler_utilitiesPrim_re_search_substr_backwardOS_encode_timeasm_generic_multiplyabort_to_interpreter_argumentPrim_prim_obj_datumPrim_integer_addapply_compiled_from_primitiveasm_scheme_to_interfacelast_return_codeabort_to_interpreterPrim_poke_shortPrim_trapped_float_exceptionsPrim_microcode_library_pathbignum_bitwise_andPrim_char_codefind_primitivearg_integer_to_intmaxprev_restore_history_offset__data_startreset_historycomutil_operator_lookup_trapUX_initialize_userioPrim_process_statusPrim_instruction_address_to_compiled_code_blockasm_nofp_remainderOS_terminal_raw_outputPrim_clear_float_exceptionsreset_interruptable_extentsighnd_terminateUX_initialize_environmentOS_channel_closeephemeron_request_hard_pPrim_greaterfixed_objects_namesPrim_channel_closeasm_generic_greaterPrim_coerce_to_closureerror_out_of_processesinteger_to_ulongfind_signal_namePrim_peek_floatinteger_to_long_pPrim_integer_shift_rightinteger_to_doublePrim_one_plus_fixnumInterpretPrim_flonum_less_pOS_directory_readwithin_c_stack_from_cOS_terminal_flush_inputasm_nofp_dividePrim_get_service_by_numberC_to_interfaceuserio_read_char_rawPrim_m_1_plus_fixnuminterface_to_Cbit_string_setbignum_comparePrim_hunk3_set_cxrasm_nofp_addffi_obstackOS_tty_command_clearPrim_make_ephemeronPrim_termcap_pad_stringOS_process_continue_backgroundPrim_negative_fixnumre_search_forwardPrim_minus_fixnumPrim_file_exists_direct_pPrim_microcode_identifyoption_unused_argvPrim_channel_typePrim_subvector_move_rightPrim_file_mod_time_indirectPrim_make_non_ptr_objectcompiler_cache_operatorPrim_prim_obj_type_pPrim_flonum_atan2x87_read_environmentasm_generic_zerosighnd_fpedouble_to_bignumOS_mallocarg_baud_indexcompiled_closure_startOS_terminal_set_ispeedcomutil_remainderPrim_set_cdrPrim_file_system_typecallout_popPrim_bkpt_pcomutil_operator_3_1_trapOS_process_hangupPrim_return_stepasm_generic_incrementPrim_full_hostnamePrim_set_current_historycomutil_reflect_to_interfaceopen_tospacen_ephemerons_requestedPrim_file_copyn_stack_blocksPrim_subvector_move_leftPrim_string_maximum_lengthPrim_zero_fixnumOS_decode_timeobject_in_constant_space_pPrim_float_overflow_exceptionUX_initialize_channelscomutil_safe_lookup_trapPrim_raise_float_exceptionsPrim_new_tcp_server_connection_acceptdeliver_pending_interruptsflonum_is_finite_pPrim_file_mod_timetrappingerror_floating_point_exceptionOS_tty_y_sizePrim_bignum_zero_pOS_open_dump_fileia32_cache_synchronizeOS_VariantPrim_terminal_cooked_outputget_band_parametersstop_signal_defaultPrim_integer_negatemake_vectorPrim_flonum_abserror_with_argumentdstack_initializeOS_get_service_by_numberPrim_terminal_get_stateenter_interruptable_extentcc_entry_to_block_offsetOS_file_copyMicrocode_Terminationsetup_interruptPrim_unassigned_testsighnd_control_g_wrapperchar_pointer_to_stringulong_to_integerPrim_update_float_environmentPrim_impurifyUX_channel_descriptorPrim_string_allocateunbind_interpreter_stateOS_file_positionarg_interned_symbolPrim_file_open_io_channelcons_alienPrim_decode_utcPrim_string_setUX_file_system_typecc_entry_address_to_block_addresstree_freeasm_generic_modulox87_write_environmentOS_process_waitOS_real_time_clockend_subproblemPrim_subvector_to_listdstack_bindcc_block_debugging_infoOS_terminal_state_sizePrim_comp_code_address_blockinteger_to_intmax_parg_alien_entryPrim_setup_timer_interruptcritical_section_hookgc_handle_quadrupleguarantee_cc_returnunblock_signalstree_buildcomutil_cache_lookup_applyMAX_RETURNPrim_restore_float_exception_flagsPrim_flonum_sinPrim_scan_backward_prefix_charsOS_expect_sequential_accesscomutil_compiled_closure_bkptPrim_file_positionOS_terminal_bufferedPrim_garbage_collectPrim_object_typeOS_pty_master_quitcomutil_operator_4_2_trapsighnd_hardware_trap_wrapperstack_guardPrim_integer_bitwise_andc1sighnd_software_trap_wrapperPrim_unsigned_to_bit_stringOS_freePrim_file_attributessighnd_control_uUX_reset_channelsPrim_eqDebug_Stack_Tracecompiled_entry_filenameterminal_openscheme_to_interface_returnpc_to_utility_indexasm_linkPrim_file_remove_linkPrim_poke_intptrvec_memqPrim_open_pty_mastercallout_continuePrim_sys_pair_consmake_cc_entry_typePrim_sys_set_carvariable_unassigned_pPrim_scode_evalheap_alloc_limitOS_real_timer_clearPrim_alloc_external_stringfind_primitive_cnamePrim_re_search_buffer_backwardPrim_char_to_syntax_codePrim_prim_obj_set_typedouble_to_scmPrim_cast_ieee754_double_to_integerPrim_process_killsighnd_control_gOS_error_code_to_messagePrim_peek_cstringgc_bad_typeOS_encoded_timePrim_get_host_by_namePrim_tty_get_interrupt_charsinitialize_historyopen_fasl_input_filecanonicalize_primitive_contextcondition_type_deallocatecompiler_assignment_trapUX_terminal_set_statePrim_bit_string_to_unsignedPrim_char_upcaseStack_DeathPrim_scan_list_backwardinitialize_primitivesOS_restore_external_statePrim_within_control_pointstart_closure_relocationPrim_ascii_to_charalienate_float_environmentheap_reservedOS_decode_utcterm_messagesPrim_new_directory_readPrim_vector_refPrim_negativePrim_process_timer_clearOS_add_to_select_registryPrim_tty_set_interrupt_enablesPrim_terminal_bufferedCONT_PRINT_EXPR_MESSAGEPrim_profile_timer_clearOS_server_connection_accepttrampoline_storageasm_interrupt_dlinkUX_initialize_child_signalsuserio_choose_optionbignum_negative_zero_bitsPrim_integer_quotienterr_printstd_gc_tablePrim_type_to_gc_typeOS_directory_closedeclare_primitivegc_handle_manifest_closurePrim_builtin_index_to_namePrim_fixnum_xorcomutil_assignment_trapcc_block_closure_pgc_handle_nmvUX_terminal_get_statecompiler_interface_versionarg_pointerOS_bind_tcp_server_socket__libc_csu_initptrvec_move_leftOS_syscall_namesstrengthen_symbolcondition_allocatePrim_flonum_floor_to_exactsighnd_stopread_cc_entry_typearg_channelterminal_state_nonbufferedPrim_record_lengthmemory_to_symbolPrim_dealloc_external_stringPrim_link_variablesOS_select_registry_resultPrim_read_word_from_memoryPrim_channel_writecompiled_closure_nextgc_object_to_raw_addresscstack_depthsyntax_spec_codePrim_lexical_assignmentcomutil_operator_1_0_trapPrim_fixnum_andPrim_new_file_open_output_channelPrim_poke_stringPrim_string_hash_modPrim_with_interrupts_reducedPrim_peek_uintsighnd_terminate_wrapperPrim_bit_string_set_xgc_handle_weak_pairback_out_of_primitivePrim_sys_vectorterminal_state_raw_outputdstack_positionPrim_char_bitsmake_primitivePrim_get_freebignum_nonnegative_one_bitsallocate_stringtermination_gc_out_of_spacecomp_safe_lookup_trap_restartinteger_to_ulong_pPrim_string_to_symboloption_show_helpPrim_pure_prenumbered_primitives_export_lengthfixed_objectscompiler_cache_lookupOS_process_continue_foregroundPrim_termcap_param_stringPrim_fixnum_to_flonumoption_saved_argvcomutil_minusptrvec_set_lengthPrim_untrap_float_exceptionsPrim_baud_rate_to_indexarg_ulongOS_current_user_nameOS_directory_valid_pPrim_bignum_equal_pPrim_file_open_output_channelOS_ctty_set_int_char_handlersterminal_state_cooked_output_ptransaction_abortCONT_PRINT_RETURN_MESSAGEmake_prim_renumberreal_number_to_double_pPrim_request_interruptsPrim_tty_next_interrupt_charPrim_memqpointer_to_scmOS_canonical_host_namedo_bkpt_proceedPrim_flonum_ceilingPrim_integer_positive_pPrim_file_link_harddeath_blowasm_sc_apply_genericShow_EnvPrim_tty_x_sizecallback_run_handlerPrim_have_select_pOS_ctty_fdPrim_integer_to_charPrim_channel_nonblocking_fp_hwPrim_integer_negative_zero_bitsPrim_link_filesave_historyread_from_fasl_filePrim_prim_obj_to_integertransaction_initializeasm_short_primitive_applyPrim_directory_makeenter_compiled_expressionPrim_initialize_liarc_object_fileUX_read_fd_statuschannel_allocatePrim_integer_bit_countcomutil_lookup_trapPrim_band_loadOS_channel_writeOS_quitdouble_valuePrim_flonum_roundPrim_poke_string_banginitialize_condition_systemcomutil_lexpr_applyPrim_integer_bitwise_andPrim_integer_bitwise_eqvlinkage_section_countPrim_fixnum_lshOS_directory_makePrim_process_signalPrim_file_attributes_indirecterror_in_system_callOS_file_set_positionOS_terminal_nonbufferedcomp_op_lookup_trap_restartPrim_float_inexact_result_exceptionPrim_disable_interruptscomutil_positiveallocate_non_marked_vectorOS_tty_output_channelPrim_working_dir_pathnameOS_announcementinteger_to_uintmaxPrim_unimplementedPrim_match_backward_cibignum_to_uintmaxPrim_declare_compiled_code_blockPrim_bignum_adduserio_buffered_inputPrim_make_pipePrim_prim_addr_to_datumbignum_bitwise_orc2Prim_substring_equalcompiler_cache_assignmentPrim_batch_mode_pwrite_fasl_headerPrim_extended_string_lengthPrim_make_charcomutil_operator_3_0_trapcstack_lpopOS_process_stopOS_free_pagesulong_to_bignumOS_channel_read_load_fileterminal_state_buffered_pPrim_string_to_syntax_entryoption_stack_sizecc_entry_to_blockPrim_prim_obj_reffasl_raw_address_to_objectPrim_get_command_linecomutil_equalUX_dump_corePrim_compiled_entry_kindOS_process_clockarg_real_numberPrim_set_carPrim_tty_y_sizecompiled_with_stack_markercomp_assignment_trap_restartarg_longmake_compiled_continuation_typedebug_edit_flagsPrim_address_to_stringPrim_bit_substring_move_right_xsighnd_save_then_terminate_wrapperOS_file_existence_test_directasm_interrupt_continuation_2Prim_constant_pPrim_flonum_cosasm_safe_reference_trapPrim_process_interruptPrim_tty_set_interrupt_charsulong_to_scmis_alienPrim_file_open_input_channelPrim_poke_pointer_bangOS_channel_blockingPrim_poke_pointertparamOS_shutdown_socketPrim_process_waitPrim_test_sel_descOS_host_address_anyPrim_termcap_get_flagallocate_string_no_gcPrim_dld_unload_fileasm_nofp_positivePrim_terminal_get_ispeedPrim_rem_from_selregMAX_PRIMITIVEOS_tty_map_interrupt_charPrim_channel_blocking_psighnd_fpe_wrapperx87_read_status_wordPrim_external_string_pPrim_file_acc_time_indirectasm_generic_divideoption_constant_sizediscard_tospacestd_gc_deathbignum_to_intmaxPrim_integer_add_1Prim_prim_datum_to_addrdeactivate_handlerOS_process_foregroundable_pPrim_re_match_substringPrim_flonum_floorreset_memoryfixup_float_environmentPrim_prim_obj_typeprint_stackfasl_object_addresscondition_deallocatePrim_integer_bitwise_orc2double_roundPrim_add_to_selregPrim_selreg_lengthmax_trampolinestop_signal_hookUX_reset_processesPrim_set_float_rounding_modeasm_generic_positivePrim_flonum_zero_pbignum_bitwise_andc1Prim_listen_tcp_server_socketPrim_list_to_integerPrim_save_float_exception_flagscomutil_primitive_lexpr_applyi386_interface_initializeUX_initialize_trap_recoveryPrim_set_float_environmentoption_show_versionfill_bit_stringPrim_file_modesbignum_integer_lengthPrim_moduloPrim_process_quitgc_handle_cc_entryPrim_flonum_greater_phistory_registerFreen_heap_blocksx87_clear_exceptionsPrim_new_open_tcp_server_socketPrint_Returnread_uuo_linkOS_terminal_set_stateOS_open_append_fileOS_terminal_cooked_outputcomutil_operator_primitive_trapreset_allocator_parameterscomutil_operator_4_1_trapPrim_tty_command_clearinitialize_fixed_objects_vectori387_presencePrim_terminal_flush_inputgc_scan_tospacememory_block_startPrim_integer_length_in_bitsPrim_string_hashcheck_fasl_versiongc_raw_address_to_cc_entryPrim_process_stopOS_channel_nonblocking_pPrim_scan_forward_prefix_charscompiler_new_reductiontermination_trapPrim_terminal_cooked_output_pinitialize_weak_chainPrim_new_file_open_append_channelUX_prim_check_errnobignum_bitwise_eqvOS_ctty_num_int_charsPrim_set_file_timesOS_pausegc_cc_entrybignum_to_digit_streamheap_startOS_file_existence_testPrim_terminal_buffered_peta_fclosePrim_add_onePrim_unreferenceable_testPrim_integer_multiplyerror_process_terminatedOS_listen_tcp_server_socketempty_listtransaction_begincomutil_interrupt_continuation_2Prim_return_to_applicationPrim_string_pPrim_reload_band_nameOS_allocate_select_registryset_alien_addressPrim_flonum_negative_pgc_handle_unaligned_vectorgc_transport_wordstree_error_messagePrim_process_status_syncdeclare_builtinUX_PC_VDISABLEfasl_raw_address_to_cc_entryPrim_integer_to_flonumhard_resetPrim_safe_lexical_referencecompiler_lookup_trapPrim_peek_intset_terminal_statecomutil_interrupt_procedurecomutil_applycompiled_closure_entrywrite_uuo_targetPrim_vec_8b_find_prev_char_cicomp_lookup_trap_restartdstack_protectetextsighnd_control_b_wrappercomp_cache_lookup_apply_restartarg_addressPrim_bignum_positive_pPrim_system_clockpreserve_signal_maskptrvec_adjoinPrim_set_fixed_objects_vectorPrim_integer_negative_pn_constant_blocksPrim_bit_string_and_xarg_integer_in_rangePrim_macosx_main_bundle_dirdebug_back_traceoutf_flush_fatalPrim_flonum_exptPrim_equal_numberPrim_prim_integer_to_objarg_ascii_charconstant_alloc_nextOS_channel_write_stringwrite_compiled_closure_targetPrim_prim_fasdumperror_wrong_type_argtermination_normalPrim_pairPrim_new_open_unix_stream_socketsave_tospaceget_object_addressMulterminal_state_set_ispeedOS_file_type_directcompiler_resetOS_remove_from_select_registryPrim_real_timer_setPrim_tty_output_channelUX_initialize_ttywrite_cc_entry_offsetPrim_write_byte_to_memoryOS_process_valid_pre_buffer_initializePrim_gc_trace_referencesinitial_C_stack_pointerPrim_set_trap_statecompiler_operator_reference_trapasm_nofp_decrementPrim_char_downcasePrim_poke_bytesPrim_read_bits_xPrim_encoded_timePrim_pty_master_hangupPrim_flonum_equal_pOS_file_lengthPrim_peek_bytesarg_ascii_integerPrim_make_bit_stringallocations_ok_pdstack_alloc_and_protectPrim_flonum_log1pvoutf_consoleopen_fasl_output_filesighnd_control_u_wrappervariable_unreferenceable_psighnd_timer_wrapperPrim_find_symbolPrim_integer_bitwise_norcomutil_negativeasm_generic_remaindercomutil_plustospace_to_newspacedebug_examine_memoryallocate_vectorPrim_bit_string_move_xcomutil_operator_apply_traprequest_character_interruptasm_scheme_to_interface_callPrim_cdrcondition_signalget_terminal_stateget_newspace_ptrreuse_subproblemPrim_object_datumPrim_non_restartable_exit_with_valueOS_pty_master_killasm_assignment_trapOS_resetread_compiled_closure_targetPrim_c_freeOS_process_timer_setPrim_integer_bitwise_xordstack_allocOS_create_tcp_server_socketPrim_floating_vector_setcopy_to_constant_spacegc_tuplePrim_peek_shortgc_handle_non_pointerUX_initialize_terminalsbignum_to_longPrim_new_file_open_input_channelPrim_hunk3_cxrgc_handle_reference_trapfind_ccblockstack_deathOS_set_working_dir_pathnamebignum_negatecomutil_interrupt_closurepending_interrupts_pPrim_assqbignum_shift_rightPrim_bit_string_fill_xprint_helpPrim_flonum_atanPrim_integer_bitwise_nandPrim_object_set_typeOS_process_jc_statususerio_confirmprim_apply_error_codestd_gc_pt2Prim_null_pchar_pointer_to_symbolOS_tty_command_beepPrim_liarc_compiled_code_blocksOS_syserr_namesPrim_integer_greater_pcondition_type_allocatePrim_process_status_sync_allPrim_baud_index_to_ratecompiler_initializeOS_working_dir_pathnamecondition_restartscomutil_operator_2_0_trapPrim_sh3_set_2comutil_multiplysubprocess_death_hookPrim_file_soft_link_pPrim_match_forward_ciPrim_subtract_onecallout_lunsealcompiled_with_interrupt_maskPrim_file_truncatePrim_terminal_set_stateobject_in_heap_punsigned_long_to_shifted_bignumOS_terminal_set_ospeedPrim_primitive_procedure_arityMAX_STATIC_PRIMITIVEasm_reference_trapPrim_substring_ci_equalresize_tospaceUX_initialize_directory_readerPrim_list_to_vectorPrim_sh3_set_0Prim_environment_link_nameasm_nofp_quotientoption_heap_sizerestore_historyPrim_decode_timePrim_channel_type_nameOS_pty_master_stopPrim_cc_block_linkage_infoPrim_bind_tcp_server_socketweaken_symbolPrim_vec_8b_fillUX_terminal_control_okOS_host_address_loopbackPrim_remove_bkptPrim_bit_string_clear_xPrim_test_selregread_uuo_targetcurrent_gc_tablePrim_scan_word_forwardoption_band_filePrim_integer_equal_pinteger_to_longPrim_file_directory_pPrim_new_directory_opentree_insertPrim_bit_string_lengthPrint_Vectorcoerce_to_compiledUX_initialize_processescompiler_safe_lookup_trapPrim_sys_h3_0comp_error_restartcomutil_interrupt_dlinkPrim_poke_doubleasm_nofp_multiplyasm_generic_quotientPrim_substring_move_leftpc_to_builtin_indexPrim_sys_h3_2OS_process_timer_cleartrap_handlerPrim_make_cellOS_terminal_drain_outputtransaction_record_actionPrim_defer_float_exception_trapsPrim_test_float_exception_flagsread_cc_entry_offsetPrim_integer_hamming_distancePrim_process_continue_backgroundasm_sc_apply_size_1Prim_bitstr_find_next_set_bitcallout_sealasm_sc_apply_size_7Prim_apply_stepinteger_to_double_pallocate_marked_vectorasm_sc_apply_size_5compiler_unassigned_p_trapasm_sc_apply_size_3Prim_flonum_pPrim_vector_lengthPrim_fixnum_to_bignumgc_cc_entry_to_raw_addressephemeron_arraymemory_to_string_no_gcPrim_clear_interruptscomutil_linksignal_error_from_primitivearg_ulong_integer_in_rangePrim_integer_bitwise_iorPrim_integer_bitwise_notOS_tty_x_sizebignum_testPrim_terminal_drain_outputstop_historyPrim_channel_synchronizePrim_general_car_cdrPrim_test_float_exceptionsPrim_reload_save_stringOS_terminal_flush_outputPrim_vector_setPrim_bit_string_xor_xgc_handle_aligned_vectorPrim_consoutf_flushOS_select_registry_lengthmake_dummy_historyPrim_process_timer_setPrim_eval_stepPrim_terminal_raw_outputOS_under_emacs_pOS_expect_normal_accessPrim_new_file_open_exclusive_output_channelPrim_c_callcritical_section_nameAbort_NamesOS_terminal_get_ospeedfasl_cc_addressPrim_new_open_tcp_stream_socketsighnd_save_then_terminateinitialize_gcPrim_current_uidulong_valuecomutil_incrementOS_ctty_get_int_charsuintmax_to_integerinitialize_interrupt_handler_vectorcurrent_interruptable_extentgc_type_codesighnd_renicePrim_carPrim_map_address_to_codePrim_get_fixed_objects_vectormemory_to_stringPrim_close_lost_open_filesPrim_bignum_length_in_bitsPrim_get_interrupt_enablesPrim_bit_string_andc_xPrim_c_call_continuedefine_variablePrim_dld_lookup_symbolPrim_host_address_lengthPrim_applyexecuting_scheme_primitive_pheap_endOS_channel_close_noerrorbignum_fits_in_word_psighnd_stop_wrapperPrim_bignum_to_fixnumPrim_char_to_integerPrim_terminal_flush_outputPrim_peek_ulongcallout_unsealOS_open_input_filePrim_pty_master_stopPrim_uid_to_stringPrim_channel_file_attributesPrim_terminal_set_ispeedcompute_extra_ephemeron_spaceOS_signal_quit_handlercomutil_greaterconstant_startOS_file_remove_linkOS_get_host_by_namePrim_sys_vec_sizepreserve_interrupt_maskPrim_file_exists_ptrampoline_entry_addrPrim_prim_obj_setPrim_pty_master_killmake_linkage_section_markerx87_write_control_wordwithin_c_stackPrim_real_time_clockOS_pty_master_send_signalasm_nofp_zeroarg_index_integerPrim_new_directory_closeOS_channel_close_on_abortOS_baud_index_to_ratearg_flonumstack_startPrim_flonum_round_to_exactsetup_memoryPrim_sys_pair_carPrim_integer_shift_leftPrim_float_exceptionsPrim_cell_pcomutil_operator_2_1_trapPrim_cast_integer_to_ieee754_doubleUX_read_file_status_indirectPrim_cc_closure_to_entryOS_profile_timer_setPrim_vectorPrim_vector_fillPrim_prim_obj_eq_pmake_compiled_procedure_typecomutil_dividePrim_cast_integer_to_ieee754_singlePrim_bignum_dividePrim_get_host_by_addressbignum_bitwise_nandgc_ptr_typedouble_truncatePrim_bignum_to_flonumbkpt_closure_installdouble_to_flonumOS_directory_read_matchingOS_file_soft_link_pRegstartOS_save_internal_stateasm_set_interrupt_enablesGLIBC_2.1GLIBC_2.0GLIBC_2.2GLIBC_2.2.1GLIBC_2.11GLIBC_2.6GLIBC_2.4GLIBC_2.3.4GLIBC_2.3          0ii ii @ii ii ii  oqi  ii ii ii ċii ti ΋ii ڋii  Y? ? ? ? M? ? "?           $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x |   ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H$ I( J, K0 L4 M8 N< O@ PD QH RL SP TT UX V\ W` Xd Yh Zl [p \t ]x ^| _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                           S[t[5 % % h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h% h% h% h% h % h(% h0% h8p% h@`%$ hHP%( hP@%, hX0%0 h` %4 hh%8 hp%< hx%@ h%D h%H h%L h%P h%T h%X h%\ hp%` h`%d hP%h h@%l h0%p h %t h%x h%| h% h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP$8 a0$ U%WVS,@T$l$T$%ЋMljD$L$%%uB{@%truW2T$D$L$$yDUD$L$DT$$](T$D$ L$T$E$蠜@t H]%RJux@JT$T$%PItL$ ,[^_]UWVS Ë=F ɸ D‰D${ $ D$.t\$$5 .$G .t$$< .u $F u.tD$$J \.ED$ $ D$ D$0.$ SÃD$ h| $ .D$$E$ -$H? $` D$? $SÃ$ l-\$$ \-7.$ $ <-.$ UVS ] D$D$ D${ E{ D$$`{  D$D$ D$D$${  aE? @ \$${  D${  D$|  $8F 1$gl={ u =|  F D$Q$9 f:ơF $D$$H A:@| rr BЁ ZB BB@| D$$~D$$ j  H| u0| DX| D$$(,|  D`| $ D$8|  (| P9,| `| 9t $]  $ D$  H| u0| DX| D$$y,|  D`| $ D$V8|  ,P@ ;,| 8| H5 r 0| 9@| vN$ G*2={ { $Ĕ D$)K$ )j*$詌$ )$ $S 8áF $覌@| ZB @| 1^PTRh hP QVh US=? u??   9s?  ? 9r? []Ít&'U tt $ ÐD$5-jÐ|$D$ D$ fD$l$$l$$% hÍ'T$ tD$D$ $"oÉ'D$t D$e5-jÍ'T$ tD$D$@$nÉ'D$t D$e5-jÐ&D$u % hÐtD$#bvSL$\$ ڃvL$\$ [hcʉȁu% h[ftL$[av'D$ t'D$D$ $mÍÍD$t D$yg5-jÍ'D$ t'D$D$@$7mÍÍD$t D$Ig5-jÐ&D$x0u% hÐt&tD$`vD$_d T$D$vD$T$Vex$u % hfD$/`&D$c T$ tD$D$$lÉ'D$ tD$ civ5-jD$ D$ Ív'D$ ( v 8 w\$ Eft&|$D$ fD$ l$ \$l$D$% hf,D$0D$$D$D$, LD$PD$8$\$D$< D${A< D$8uwD fكLf%D LÍuD$80 zzD@ \$$\$ \$D$D$ ÍS\$ D$D$$0j1҅t$ah[Í'S\$ D$D$$it$`Áh[ S\$ D$D$$i1҅t$g$:#ƒ[ÐT$1u؍t&ÍBwwrÐt& < DÍD$%@wwr6Ít& < DÍt&1ÐD$wwr6Ít& < DÍt&1É',D$0T$T$%@$Dƒ,Ít$,D$D$4$L]t4$0TƁh31mt j,$P$t&j+jxilj%=u_% hh1t&j<$TPt&ى둍&tT$<$ PT$f݅x߉Xى፶t$t$ \$\$$t1\$4$iJu3؋t$\$Ðt&tXj4$tOD$D$$x[t$\RËt$h؋\$É1ہjwtt\$t$D$ N&j$N'VS\$ t$$t'$t$Ku)[^ÐtPj$TND$D$$XZt$t"t,1ۉ؋t$\$|$? d 5? ܍Ct$|$$xS҉Ct21Ʌt9P1t2x1Ʌt9C1Ʌ҉SXt s1҅t9L1ɃXt 9щMуBt&Ct$|$$S҉Ct21Ʌt9}uP1t2x1Ʌt9Xs1ɉSt1t29ΉM1ɃXfc1Ʌt1t9L1Ʌt 1҅t9Lуw$p x@@Avz1ɉBpxt1t79M΋r1t9LЉyt&r1ɉBptx1t79M΋r1t9LЉt&? H ?  VS\$ t$$tC 4$D$ u [^Ít&t uӋ[ΐ[ȍt&'<|$4|$@l$8l$D\$,t$0VT$T$T$aT$CCP D$HCT$Hl$4$T$oT$)׉CD$D$H<$D$DD$JS1Ʌ҉Ct 1҅t9Lу؋t$0\$,|$4l$8<Ít&? ))֣? +&uu$t=T$Hp @P@늍t&? H ? ? H ? T&'UWVS,\$@- s~2o EtzPt2JD$T$ $T$J $T$$ D$Pt2JD$T$ $rT$J $cT$$D$$EtzPt2JD$T$ $*T$J $T$$D$Pt2JD$T$ $T$J $T$$fD$$Z,$Ro EtzPt2JD$T$ $T$J $T$$ D$Pt2JD$T$ $]T$J $NT$$D$$EtzPt2JD$T$ $T$J $T$$D$Pt2JD$T$ $T$J $T$$QD$$E,$=<$5~2o EtzPt2JD$T$ $nT$J $_T$$D$Pt2JD$T$ $5T$J $&T$$D$$EtzPt2JD$T$ $T$J $T$$bD$Pt2JD$T$ $T$J $T$$)D$$,$o EtzPt2JD$T$ $YT$J $JT$$οD$Pt2JD$T$ $ T$J $T$$蕿D$$艿EtzPt2JD$T$ $T$J $T$$MD$Pt2JD$T$ $T$J $T$$D$$,$<$4$s~2o EtzPt2JD$T$ $T$J $T$$蓾D$Pt2JD$T$ $T$J $T$$ZD$$NEtzPt2JD$T$ $T$J $T$$D$Pt2JD$T$ $dT$J $UT$$ٽD$$ͽ,$Žo EtzPt2JD$T$ $ T$J $T$$~D$Pt2JD$T$ $T$J $T$$ED$$9EtzPt2JD$T$ $T$J $yT$$D$Pt2JD$T$ $OT$J $@T$$ļD$$踼,$谼<$証~2o EtzPt2JD$T$ $T$J $T$$VD$Pt2JD$T$ $T$J $T$$D$$EtzPt2JD$T$ $`T$J $QT$$ջD$Pt2JD$T$ $'T$J $T$$蜻D$$萻,$舻o EtzPt2JD$T$ $T$J $T$$AD$Pt2JD$T$ $T$J $T$$D$$EtzPt2JD$T$ $KT$J $)ωx>\$t$|$ l$f@1wL$Vv4^볐<$f`f^Սv$VwۍvUWVSu9+=Ӊ9t$L$ \$T$ ډۍ9}؁?vD$$eL$ 9D$ti L$ʉ T$v9}؁?vD$ $T$ ЋT$,T$ T$[^_]ÐT$ T$뜍t& *D$,[^_]Ít&T$,1럍v'UW%VSHL$,JX@T$(D$$ʍˉD$B\$0\$,T$D$BۉT$ D$tD$,%PTT$$D$09D$T$)ʉT$ vl$L$;D${YQL$D $L$t$D|$ l$ L$T$9' 9&D$=?vl$ 1T$9T$(D$L$L$ 1ҋ\$(t$4;Ѓl$%t$l$|$%ց Ƌ׍W)@II9\$qwt$4҉t )ӉxWT$,tL$$AL$$D$9D$0yH[^_]ÐD$?YAt&9v@l$1ۉT$ L$(f1=?G9͉BwڃtF` A?=@C፴&'$Á|${Kt$l$ k49w~Vuv9w:t9vK)ʁ@1ɅE щK )ʃt5vT ʉ$t$|$l$ Í&DЍU%WVSHˁ?\$ tZ߁?t@t胰v@u9|$ H1ۍ49sU)‰Ѝ3UUUU)Ձ33333333Չ?9wD$ )<19sNUUUU)ց33333333։?9r[^_]Í|$ L$ Љt&'UWVSÁ,wk%??9r ʼn߉Á?""?D$D$$9q|U|$<9T$sv+ *)9w\$49sf9w,[^_]&衮U%WVSSD$D$0%@ D$,)l$AL$(Kt$( L$ L$D$8D$$1;T$ s2|$<ǐ2D$$!L$ 9T$ wۉ|$<9\$8{t$,D$(T$41b9\$(s3l$l$(T$L֍t&4$T$L9݉rl$ƋD$0L$4\$ptVED$D$$|$xqҁ@Qt$p\[^_]=""D$,D$D$$蛳D$01%@ D$,qt$(ASC9)ً9w1t&D$$4BF9؍T$Ll$l$(փ4$Q9rl$'UWVSL^T$T$ T$T$ ?L$,z?)""jD$D$$U|$dD$0%@ B""D$D$$D$(%|$hD$$L$$%@ ؃AT$=1ۍ&=v""1D$D$$脱VD$)\$L$D$8%x|$$D$4F|$|$$D$G|$D$<;T$D$s*ߐD$!L$ ݉9T$wۉ;t$<o|$ 1T$ t$4G|$4D$G;T$D$ s,ߍvD$!L$ ݉9T$wۉ;t$ unL$0T$8D$(:t$`|$$ًG|$;D$vwl$1҉|$t&ً0 ׋T$8!;D$wtFVF 9s|$$)v09w|$$L$0T$D$(D\$,tD$0FL$,L$`tD$(/|$`L[^_]ÐD$0Mv..щSˁR[??9w[&[‰&'D$D$$BÍ&'D$D$$|$ Aҁ@QÐ& T$$D$t$|$J?tI1^?t$@uT@u??19tJf$t$|$ Ð%$@?t$|$ Í&@u뾍Z<9sN09JuJ )֐t&9s19t1넸zv'D$%P1?t  T$L$t$$B|$Ɓ?u1Q1?t@$t$|$ Í&Y߁?u$t$|$ Ít&@ta@t9|09stV9S|C)ڋ<2989w1_t&@I9?709'tK9N C)ً<198|9w1f&SD$\$ R?t4فI?t#@t!@t9ڹ[t&[Ít&@t[1[~‰[&'\$\$ t$D$$|$ځR?u&Ɓ^߁?uq\$t$|$ÐI?t5@@ڋ\$t$|$&؋t$\$|$Í""@D$D$$|ҁ@ Q^V92)΍& 29w\$t$|$Ít&@t 1ɉ‹t$؋|$\$‰&t&UWVSÁ,wk%??9r ʼn߉Á?""?D$D$$j9q|$<9T$s&+#*)9w|$9sf9wD$D$$B@B\$$c,[^_]ƕUWVSÁ,wk%??9r ʼn߉Á?""?D$D$$:9q|$<9T$s&+3*)9w\$49sf9weD$D$$跧B@B\$$5,[^_]蘔&UWVSÁ,wk%??9r ʼn߉Á?""?D$D$$ 9q|$<9T$s&+ *)9w\$49sf9w5D$D$$臦B@B\$$,[^_]h&D$ t$\$|$Ɓ^߁?u\$t$|$Á""wt@D$D$$ҁ@ Q^V9s)΍& 29w\$t$|$角&U1WVSLt$dD$`ǁkO@@t 1@?L$,?L$$L$,L$ ?l$$9l$,؉Njl$ ""T$D$D$$轤T$ځ@D$<% D$4 l$49ȉUs9wT$ C4D$,|$09ЉT$8t$(L$4D$,)ىL$4t&l$,1D$4Ul$,l$(с9l$0L$ T$$slT$0v2݃L$ |$$l$ t$$݁ (9T$(wD$,9D$8SD$&9 ЉƉ  9͉1rɋD$T$L$H|$LT$1tjD$T$D$$踡T$Á|$SɁ@KD$@L$HL$L1\$,t$0|$4l$8@u?1 19s-Ƌ9r[^_Í&11[^_{t&'UWVSl݄$D$\T$8$D$t$\)n""h\$ D$D$$ܒD$8ɁD$41D$ %@ C,D$85щk)ΉtM|$N1t$@|$Dt$Nl$@)L$8 fD$Ll$LT$Hl$Nt$Hut$HD$H9|$Nr\$L$8T$N fT$LG 9t$l$LT$Hl$N|$H|$HD$H>sctiÉDDŽuaw )ȉ1l$L\$Hl$ND$H!9t$>r t&؋D$4l[^_]ft&؋\$f9rD$4l[^_]Í&D$D$$D$4%@D$D$$D$8ɁD$41%@BB1wB}vUWVS<\$PCD$%?u<[^_]Í&<t;ST$$D$  щ ʉ щ ʉUUUU)ʉс33333333щʁʉѺ?5&!5T$,D$,)  ع D$ <D$?)Ѿ,6#L$#L;L$,D$,l$(D$ߋWtMu<|$(@T$(u(tNx)T$$ ut&tTtl$,D$,D$~kD$ $D$蕇[\$D$@Q<[^_]ÍT$5$LɁ?L$,D$,t ؉D$ vtPD$<D$(@ G C@ &l$l$(\$ D$ t$L$$|$t}%pxA?9w1r-Ck)9|uRZ'VSt$ \$$D$D$$gmB@Bt$$D$D$$'mB@Bt$$\$$D$ [^svVSt$ \$$D$D$$lB@Bt$$%D$D$$lB@Bt$$\$$D$D$$;lB@B\$$D$ [^vUWVS,|$@M  ‰ Љ ‰ ЉUUUU)Љ%33333333‰%ȉ?L$Dk94""D$D$$TkËD$D|$HL$D$с@ ƃ҉Htщu4D$DL$Dk)ʹ%?)tv%?u,[^_]ÍvD$D$$j%@,[^_]W&UWVSP$Pf8| u!Ru,T$$t$O$O$O8| u!Ru,T$$t$^O$O$FOVS$8| utD$$D$]R$賴t/D$D$ t$$D$ D$|[D$$[^ÐD$ $h!$[^$Nv'8| u5-j$$jNv'8| u $$i$4Nt&8| $it8| %@$$Mv8| u $Ti$Mt&8| u $$MD$L$ Í&'T$ A#B BÍUWVS L$4|$89g9)պ )9߉$))T$ $^\$ XT$T$#\$#V ډV+$v~L$ T$T$)֋T$\$\$ 4$D$Gt$#w#D$ ;$uۋT$D$ڍ L$ T$tD )L$ v#q9)уL$#X t$ ^ [^_]Ðt&$ )$);<$! $T$1 $X\$+<$D$ #X)l$ Ӄvk $Љ|$T$T$t$t$ )$B#D$ ؉;$u|$t$ߍD$|$9T$L$ B#D$ ؉F)H L$#VЋY! ЉF [^_]Ðulv/ ڍ1fLL9u) )#P#N щN [^_]Ít& )Ӻ9ك#Vsf)Љ׃L$#FQL$ ! ؉Ft&@)#^! É^ [^_]Ít&@ $)#^! É^ [^_]Í)L$$T$#P $ + $#X ڋ\$ SI)#P#N щNYt&S\$ D$$/CD$G\Z[Í&S$LD$$/Í@D$[Z[Í'8|  /EÐt&SD$|$ %Hҋ@t ۍ vTu[Í'D$%P@t"ٍt&DuÐWVS$KD$$/XCD$Z8| qy z҅tލ ލ Tu[^_Ð&S8| /uEz%Hҋ@t ۍ vTu [$F'8| /u%@ h$F VS8| /u;$H;C}0Ɖ#T% [^$SF$wF&S8| /uC$H;C}8‰1\ Kt Ҹ !ʉS[$E$FVS8| /u[$G;C}8‰ \ st [^Í& 1S[^$E$SEvS8| /%P\уu< t*K1u!؍\uPu [ÐH1Ku t݋K1uԉ؍D u uf1[$D'<8| \$,t$0|$4l$8/ @/ӁQ1;St\$,t$0|$4l$8<Ð34~KL$уtY 3u tL$1I9OuLD t&9uPu l [L$1I9OI 9uu붐1$?C$3CvVS8| @%pJ9rXu@0B~$ f [^$BVS8| @%pZ9rHuB0B~& f҉ [^$jBv'WVS8| @%Hr9JXu@ 8A~#ː  [^_$At&'WVS8| @%Hr9JXu@ 8A~#ː !  [^_$kAt&'VS8| @%pJ9rXuB0B~& f! [^$@v'WVS8| @%Hr9JXu@ 8A~#ː 1  [^_$k@t&'<8| l$8\$,t$0(|$4/$A$Aá8| x /$A9;]~ډ)Љ;Ai1T$ƒtf )1҃|$u@t L D t$<$ \$,t$0|$4l$8<Ív +T$$D?$8?$,?$>$>t&WVS0$Bơ8| XI$U,sb^CD$D$$/QۍJrt8ٍt&Du0[^_Ít&10[^_Ít D9w9u~GD$D$$/QqQ1tލDuY0[^_Ð^CD$D$$/PۍJr"ٍ&DuD$t$$<~GD$D$$/3PqQ1t$ލ&DuT$,$D$L$,T$ D$pD$D$0[^_Ðt&$<$X<&WVS08| /KDxt@#pѸht څt $t&u4uh0[^_Ëpȍvv D9rщ hvqAL T$,L$(tڃt )эQT$(T$(D$D$ T$D$$0[^_$!;,8| t$ \$|$$pl$(/^$<8| ߃ ؉ƒt )Չt7 ){t \$,$A &u% \$t$ |$$l$(,$_:{1t 룐,8| t$ \$|$$pl$(/^$<8| ߃ ؉Ńt )Յt7 ){t  \$,$q &u% \$t$ |$$l$(,$9St 1룐UWVS,8| 0/$X;$J;;A9ǃ։T$ڃ9D$ҋkt )уt$9t#t9u|$ tL$1t)1ҨuɃt,h,[^_]Íuԍvt,hƍ[)у tDуtut&t,hsvug&1ҨGɃt,h3$w7$7$7 L$D$%T L$ t BBÍt&#BBÐS\$ $>t[á{ \$$ D$Nu$ "f$ Ð&&t&'UWVS,=F tivu)D$D$$ K9D$s(ʼn$)9*rD$,[^_]D$D$$ JD$fUWVS,{ 5{ D$$ \$uJ<9D$s"ʼn$)9߉*wD$,[^_]ÍUWVS,5{ D$tY{ D$$ \$ށCDZE؉t$  ؋\$$0vD$$2 Ã8| uw% h$B0$f08| u1w h$/VS8| %Xp t!%ts[ u߃ [^Ðt&@%$[밉'UWVS58| t$%0D$P51vD 9uT$1 @| 4$T$ t$ D%8 T$XrP u#t&BZ= %(Et%<$)DQʃ뤍t&t$Xhvt$ t)uu4m +uލ&9<$ @|  [^_]Ð%<$1t$DQʃ%Xhn\= \$LÉt$P|$Tl$X= = ;| ;| Ɖ7vX  D$D$ $1j|$D$ $j\$Lt$P|$Tl$X\Ít&$ D$• $ifD$ $ifD$ŕ $ifD$ȕ $ifD$Օ $ig&D$ $diG&ҋ) D$\ $4it&@+E%@FD$,t+1ېt&D+D$ $D$h9u9t$,vD$ $hD$ $hxD$ $h7  [7‰] D$ $;ht$D$(D$< D$ $hD$(E[7‰ D$ $gt$D$(D$< D$ $gD$([7‰ D$ $ogt$D$(D$< D$ $GgD$(y[7‰Q D$ $ gt$D$(D$< D$ $fD$([7‰ D$ $ft$D$(D$< D$ ${fD$([7‰ D$ $=ft$D$(D$< D$ $fD$(G[7‰Y D$ $et$D$(D$< D$ $eD$([7‰ D$ $qet$D$(D$< D$ $IeD$({[7‰ D$ $ e 5[ t)  D$C $dD$ $dvD$G $dW&C\$D$8 $_dBf D$ $5d3D$ D$ $dK[D$ D$ $c D$ӕ $c&:1ҋLt&D$ $c; w t 8\$D$* $RcD$ӕ $>c!j\$D$ $c&@;o@Ft&1D;D$ $D$b9u9D$ $bvD$ $~b{1Vv< |< < t&fP^D$D$ $!b9D<"`~<\uD$ $a̍t&D$ $a[D$. $ao&D$ $~a%@|$ T$(D$H $%D$@aT$(D$ $aC1UD$h $at&ƽi D$0t$$;{|$0 kD$0$x |$D$n $`D$ $`C8u%@1t&1ҋ,t&q1ҋC%@`vt܁D$ $_C1%@(|$D$ $_vD$Ζ $_F vD$D$2 $_/t$D$ $i_3 &$t$l$D$C $D$ 0_$$$0ƁFD$p $^%XP9sАt&/D9wT$D$ $x^FD$x $5-jD$S^q  $ $É$sځT$D$2 D$C $D$ ]|$D$` $]fD$ $]&D$ $]oD$% ${]VD$" $b]=t&D$ $D]'&D$( $$]@;o@F91ۍvD;D$ $D$\9u D$Ė $\C1%@|$D$ $\fD$ $d\1|$D$ $C\D$ $$\1ҋ{$D$(D$p $[D$(%XPЁ9s&/D9wT$D$ $[QD$< D$ $D$(s[D$(D$(D$< D$ $J[D$(BD$ $-[l\$D$ږ $[ (  ?r WVS=8| fD$D$ $(Z8| 8|  tOD$ D$ $Y''D$ $Y8| 냍vD$ $YD$ D$ $YD$ $jY8| 08| D$ D$ $?YsD$ $YFt*t&8| 4$`8| =8| $Y[^_Í&D$ $X8| &\ \$LӉt$PƉ|$Tl$X  ;| ;| ׉7vS ! D$D$ 4$Xl$D$ 4$Wt&\$Lt$P|$Tl$X\Ít&$ D$• $W΍D$ $W붍D$ŕ $W랍D$ȕ $W농D$Օ $hWkvD$ $PWSvɋN D$\ $(W@\$(d$(D$(@%@FD$,t)1ۍvT$(DD$ 4$D$V9u9|$,vD$ 4$VD$ 4$V$D$ V7  [7‰g D$ 4$9Vt T$$D$< D$ 4$VT$$e[7‰ D$ 4$Ut T$$D$< D$ 4$UT$$[7‰ D$ 4$yUt T$$D$< D$ 4$UUT$$[7‰m D$ 4$Ut T$$D$< D$ 4$TT$$E[7‰ D$ 4$Tt T$$D$< D$ 4$TT$$[7‰ D$ 4$YTt T$$D$< D$ 4$5TT$$[7‰ D$ 4$St T$$D$< D$ 4$ST$$%[7‰ D$ 4$St T$$D$< D$ 4$uST$$[7‰ D$ 4$9S[ t' D$C 4$RډJD$ 4$Rt&D$G $RvC\$D$8 $R N$D$ qR;D$ D$ 4$WR[D$ D$ 4$.RډD$ӕ 4$Rv1ɋQt&D$ $Q; w t 8\$D$* 4$QD$ӕ 4$Qt&j\$D$ $hQkv@+U@FT$(t&1ۍt&D+D$ 4$D$Q9u9|$(D$ 4$PD$ $Pk1Z&< 0|< t&d< GfP^D$uD$ 4$}Pt&9=D<"~<\uD$ 4$JPЁD$ $2P[fD$. $Pv$D$ O%t&l$ L$$D$H 4$%D$OL$$D$ 4$OS1ɉD$h 4${O~ׁD$0|$$i C|$0 3D$0$x $l$D$n OD$ 4$OS8u R1ɉGf1ɋ)t&41ɋC%Pt܁$D$ ~NC1%Pl$D$ 4$VNY$D$Ζ :NF D$D$2 4$No t&T$$$\T$$|$D$C 4$T$D$ M$蔸9$蔵$ܷǁGD$p 4$pM%XP9sАt&/D9wT$D$ 4$,MGD$x 4$5-jD$ Mdq  $誷 $շÉ$+ځT$D$2 D$C 4$D$ Ll$D$` 4$LfD$ 4$xLvD$ 4$`LD$% 4$KLD$" 4$6LD$ 4$ L#vD$( 4$L|$D$ 4$K@+E%@FD$(1ۍvD+D$ 4$D$K9u$苶$D$Ė nKC1%Pl$D$ 4$FKI$D$ +K1ɉl$D$ 4$ KD$ $J1ɋ늉D$$D$p 4$JD$$ZB9s&/D9wT$D$ 4$JwD$< D$ 4$T$$[JT$$T$$D$< D$ 4$6JT$$D$ 4$J.\$D$ږ 4$J]vok\I 6 S\$ $u\$$<‰At ̗ t[ËuIuЃ%[f$ȳ똍t&UWVS,t$@D$D$F f %%x/E|DD$ D$ $D$4HD$fDD$ D$ $D$GD$1$ %I9uD$u ,[^_]Ð$ ID$p t1ۉǐD%(D$ D$ $GD%hD$ D$ $RG$ zH9u,[^_]́JT$D$ʉ wD$@ ,[^_](H&D$ $ D$ H %; w t:u/D$D$* $FD$ G&T$D$2 $`FD$ G8| |$ pGKH1Ðt&WVSD$ %X%49s;ߍ)D$$' $G$  G9w̓[^_Gv'SD$$\$ 8tD$D$ $E[&T$$D$ $ FkGt&'\$\$ t$|$D$ $ED$ D$ $D1D$ $D8| 08| D$ D$ $DD$ $DFtt1t\$t$|$f吉4$踌8| ՐUWVS-8| \$0萍t&D$D$ $$D8| 08|  tKD$ D$ $CE'D$ $C8| 덐t&D$ $CD$ D$ $C؁D$ $tC8| 88| D$ D$ $MCD$ $/CFt*t&8| <$p8| -8| \$0[^_]CfD$ $B58| t&S8| D$8| X8| [Í'S8| 18| [ÍUWVSl$eD$\1$. CF D$D$2 $BF ,$ HC~11ۍ|$4t&\$D$ : D$(D$<$8| |$40t D$,|$D$ $AD$,$ B9|D$\e3u6l[^_]É\$D$ږ $SA$ B>] 'Ív' Ív'$h ABC'$!$3WVS$ @| L| 9эr 50| 9r9 t8G 99sg$Κ A$ &|9r΁Y~1t&T9u؍É@| [^_Ð $ D$H  H| u0| DX| D$$,|  D`| $ D$@| +G D| $ @$  VS8| @| L| 9s7 t? G 99sd$Κ @$ 4t& 0| 9sp 9r$%D$@D$@[^Í $ D$  H| u0| DX| D$$,|  D`| $ D$@| +G | 0$4$ ?$ <8| \$t$uB$%D$5$? \\$t$$8| u%% h$iU1WVS,Xr<9,t79uf9vs9t99vۃ9u) $;Q9߉D$@tK9t|Pl$v9߉ЉJt+9t$t[ (9)t r߃ۃ9߉ЉJuՋl$9v9wD$,[^_]Í)of9vڍt&9wD$,[^_]Í&'@ @  @ ÐUWVS,\$D$yq҉C,PX9݉w#Ƌj4$D$NP9݋D$wމ|$$D$P@ D$GD$H@ T$@G W,[^_]Í$Of$FP랍t&S\$ C$O\$ [ $pT$ T$$PS\$ C$O\$ [\$\$$t$t$ $ @ pt$X\$D$$D$ @ w!&UWVS@ |$0ۋptICtD$4$ Pt&-p| $@ D$!!<$S,$3 u[^_]Ðt&\$\$(t$t$$|$|$ $ @ x|$pt$X \$D$$D$ @  &WVS @ D$$t$ tAx1u $vt"9suC<$D$.OtC[^_Ã1[^_Åu ꐋt9suٍvUWVS @ D$0ts1ۋxtC<$D$Nu4$]M @ ۉŋpt'C<$D$NtCu߃[^_]Ðt&t t&u$LŋP @ tʐH u[^_]ÐS$$r tt $t&^ ,[Ð;F w  `[$Zv'$8| J9u? tt%$%^( hÍvȃ% h$$&8| u$%;F w#F % h$\$8| u(%;F w'F 1t$h$$,F D$h h$ 8| u"%;F w&F $ޚÃt$y$'S8| uq@tL= tUuj5-j\$D$ L$$cG[Í11۸ΐt&1ɻ뻃t$$D$1"DÍt&tA A 4| A  A A A A `| A | A uiA A A tA @@@DÍ&A  1A A A yt&| A | A | A 땐&S\$ C$= t [Ít&D$ [QL$ D$T$I)L$ D$ V5 @ S$@ 9st&H9؉ rt$ [^i \$\$$t$t$ %${  t\$$\$t$ t$Mt&,@  S=hA \$ u$D$$D$${ C[$8? ,{ t$$t$4|$(\$ \$0<$ t|$( Ɖ3Ct$$\$ ,f{ D$D$<$D$ P$D$kWD$D$P$TWD$돍&',{ \$ \$4|$(t$$t$0߁<$ t|$( ÉF\$ t$$,f{ D$D$<$ٺEщT$PD$$VD$땍t&T$D$uÍt&T$D$Ut&'pA Tt&pA Lt&SlA \$ D$D$$$CC[É'<|$4|$Dt$0t$@l$8l$H\$,<$V$@  (@ 9r> @ )L$$T$L$fT$L$)Ӄã @  (@ 3C$@ \$,l$Hl$8|$D|$4t$@t$0<1[^_]Ít& PTʐt&D$$@@ SHA PLA PPA @ Pt@ @$A 0@ `@ T@ `@ @ `A @&@ 0@ Wl$$R[< [^_]$$L8| \$<@| t$@|$Dl$H$x8| @@| L| 9r 0| 9s p9sFtA L| X P\| P(T| P,G t PT<$D$,D$<$Al$,tA l$$tD$u(D$,$<D$% t&tA Pl$@ $)D$ttA P(l$@,$)D$ttA l$@<$D$ptA l$@D4$D$D$G&<$谇G$$$ +$ $D$ D$ $1҅t T$$ЃfD$ $qÐ&VS$\$؍v$9r2BD$  ȉD$0Bz B ȋJD$@BD$TB D$$ D$ B ) D$B$J( D$\ D$,B,)ȋJ0 D$( D$4B4) D$XB8 D$8B< D$`t)v`9 9u$ SA D$ T$É$A J9r;B r,J(9s p [Ð;B,s)\B  [Ít&)XB  [ÐSA D$ T$É$A J9r;B r,J(9s  [Ð;B,s)\B  [Ít&)XB  [ÐVS$8| p%0҃L$9A B,+B(9B 1+BZ<Z81: @| ;L|  ;A  A 5 | | D$$   H| u0| DX| D$$k,|  D`| $ D$H| t& 0| 9I؍9<G D$A $[^Ðt&rTG $^$|$D t ${ËF 1t${ËD$D$Ít&'SD \$ t\$$s,[Í$L+D @[Í'VSD X49s f9w[^Í&UWVS,8| t $i8| =C%$K\$Ɖ$C$0@D$D$@$L$gA B +Bz<z8j$1: ljl$|$B,+B($A C?  B$D$B,+B($D$1G ^D 5D t$_KD$$D$$   H| u0| DX| T$$S,|  D`| $ D$*S҉| $MV8|  , <| BB8|  B (|  d| D$$ l| D$$ ~=| uhP={ u9? $v$T7BT$A ? { ? ${ @&$f\$\$ t${ut$\$D$ uIwD$ D$$ ơ? D$ ?~\t$$ $H $˜ D$$I/={ uY? $ ` tD$t$$ Q֋` t$$ D$2q? { ? ${ 됐8|  EÐt&8| 1tÍv% Í&8| uh Eƒ$ '8| u5-j% $v'8| u5 ҺNƒ$f8| u7Ru65j9Ѹ Eƒ$($8| u7Ru65j9Ѹ Mƒ$$8| u7Ru65j9Ѹ Nƒ$H$<8| u(5-iu% h$t$&8| u(5-ju% h$t$&8| u=RuL5,u% h$t$2$8| u8RuG5)Љu% h$t$${t&'8| u*5-j؉u% h$&t$FL$T$l$|$ jȁj1)ʼn1)lj\$t$uy,$1wE$w4݉u?9uCt?) hv\$t$|$ l$Ít&1ttt&֍ hƍ&'8| u!Ru,T$$t$$$VS8| HjjxU}ډƉډ%=u{hh4$T$[^Ðۅxډމډ막ى䐉ىz$}$$$t& 8| uJIuejtK5-ju% h$%t$E$9$' 8| uxIu_jtE5-jx,%=uHЃ% hÍ&؉$$c$Wt$w&8| uXJuW5-jj1)Љ1)ufщȅu% h$$t&'8| u%Ru$%҃! h$j$^&'8| uRu!Ѓ% h$$8| uRu Ѓ% h$$8| uRu1Ѓ% h$r$f8| uЃ% h$08| u]Hu\jx#hw% hÍ&ٸhwЃ h$$&,8| u5-jD$D$$b ,$b=D t $D HÍt&$=Í'\$t$$iƉÁ4$u4$u؋t$\$18| ueB%uD$u0$D ,u D $D uu  $$Kt&'S$ i%$u.$D uD $D u[G&8| ueB%uD$u0$D 0| DX| $xu&  hÐt&S $ y$%D$u  H| u0| DX| D$$3,|  D`| $ D$؃ h[Ít&S $zx$ %!؉D$  H| u0| DX| D$$蟃,|  D`| $ D$| [fS $w$%!؉D$Q  H| u0| DX| D$$,|  D`| $ D$؃ h[S $Zw$% ؉D$  H| u0| DX| D$$聂,|  D`| $ D$^؃ h[fS $v$ % ؉D$3  H| u0| DX| D$$,|  D`| $ D$΁ [Ít&SWq 8| Љ  ,  B R8| H9,| `| 9t $] 6 $ D$.  H| u0| DX| D$$,|  D`| $ D$ɀ8| BZ8| B$$ Iq'S8| B (tAp8| P9,| B,`| 9tA$] =t&(u$8|  -8|  [Ít& $ D$  H| u0| DX| D$$,|  D`| $ D$8| PX8| @$&$qq% Í&'S $s%!9C [Í' zl| z Ðt&xn8| $t t $ol|  8| $%l| v'WVSn5l| 8| ;J%9t2u*HA%9u% ȉ8| q|8| P9,| `| 9t $]  $ D$}  H| u0| DX| D$$},|  D`| $ D$s}8| Px8| @$ <| Ív'8|  u$ѡ<|  Dv<| $m$mS@| L| 9r0| 9 H  G 99s$Κ ѫ$ uYt& $ D$x|  H| u0| DX| D$$6|,|  D`| $ D$|@| +G | lH 9.T$ T$$ @| PT$(P [$ $ X8| PT$PT$$Í8| $u)D$$n8| à t$lt&S8| $u0D$$1n8| R [à t$kv'8| $u8| %$hk&8| $u8| %@$'k&8| $ku8| %@$j&8| $+u8| P% $j8| $u8| P%P $_j 8| $u8| P%P $jUWVS<| %h%%Px9s(ŝt&iÓ19w%1؉1ҁ;|%t@9t x@܍t& Ɖ7[^_]Ít&UWVSÃ<| ,%9Hs*пŝt&iד819u%11ҋ9D8fu!t8t߃7tڃ[^_]Á%P9tG릍\$t$$muۉ뵍'G ;L| ;@|  $ D$Xw  H| u0| DX| D$$w,|  D`| $ D$v@| +G | g$Κ  $ S$ $ S&D$bfD$7Rf T$D$Eƒ Ív',\$\$0t$ t$4|$$l$(؉8ʼnt|t$$R@| ;L| s tv 0| 9sZ9rۉ׃t@| BD$ |$$7e=E\$t$ |$$l$(,Í,\$\$0t$ |$$l$($nډ8ʼntx\$4$~@| ;L| s tf 0| 9sZ9r߉׃t@| BD$ |$$7<E\$t$ |$$l$(,Í\$\$ t$|$%P@%0ljtk@| ;L| s tt&0| 9sH9r܉ƃt@| %@D$ t$$7;\$t$|$Ít&'\$\$ t$|$%P@%P0ljt"ށtD$ t$$7R;\$t$|$Í&'8| T$ Du%%Ãt$d8| T$ Du%%É$ct&'8| u+%P@%WEƒ$uct&8| \$t$|$%P@%0ljtj@| ;L| s tt&0| 9sH9r݉ƃt@| %@D$ t$$79\$t$|$$b S8| uK%XPi9s*ŝfi 19w%1 h[$$bt&VS8| ucrB9s$ŝiʓ19wӁ1$}e1҃[^h$aF 1ɋD$҉tJp| HF PÍVS5 \$ D$$F wp  H| u0| DX| D$$5p,|  D`| $ D$pC$ǃt$$p  H| u0| DX| D$$o,|  D`| $ D$oF [^Ðt&VS$F \$0>5 D$$jo  H| u0| DX| D$$(o,|  D`| $ D$oF @$赂t$$n  H| u0| DX| D$$n,|  D`| $ D$nD$$`{ L|D$D$ D$D$$`{ zF \$ $\j$ p[Kt&'F Ít&U1WVS,F D$ptPp| T$tD$xD$pF D$|$bXA3S ]D$$ef=(|  #  8| <| h P ], @8|  P D$$,e=(| l? ^<| %@<%PA8| P8| H(| f$D $ %$fP - D$$dP ], @8|  PD$$  $d_&w '9l9^h:f0]فQ9t)9@| ;L| r0| 9    P ],@ H ., PP8|  P $ D$j  H| u0| DX| D$$j,|  D`| $ D$yj # 5| $@Wv F <9 +F 09t&t$$j F 8| p| 8| @| - =l| - T$,G T$,;p|   8| G  =l| 458| =(| t ? N 8|  V%^ V 58| D$$0GafX\$@8| JL$MY;Y9t$ށ9l$l$0D$?l$0=@| );=L| ll$8|$46-0| 9l$H$|$?D$(tl$+l$0l$(l$(|$8|=l$4l9l$HD$4l$8|$ HD$TD$4(Ń;|$0ktCl$dl$41|$h|$@L$lt& L9ul$d|$hL$lD$@8| T$0)~1t&D 9ult E ~1Dȃ9ulD$TT$T-@|  T$ $wff   P ],@ H ., PP8|  P $ D$f  H| u0| DX| D$$f,|  D`| $ D$f1|$?t |$+|$0?T$8D|  # $4S&SVD$$O^f3VD$$ /^jfVD$$^JfU # $RIv     T$$d=(| t ? * 2 58| t&$@t58| fCUF $,[^_]ÍvF  $qٍ& 58| qv8|  ],  P@8|  P{ D$ $\8|   P ],@ H ., PP8|  P # $Pt& 58| kv N    T$$b9t&$8 8|  J ],B Z ., JJ 8|  J$.P$ $_8|  B B8| J9,| `| 9 $ D$b  H| u0| DX| D$$b,|  D`| $ D$b8|   ., PP8|  P $ D$Ib  H| u0| DX| D$$b,|  D`| $ D$a@| 1;L| r 0| 9s)|  # $N$ |9fH\׍jH29p|$L-@| t$P58| v<)Ӄ<1ېt&tt9uD$P|$L8| @| = |$ $)`rt&8|  ], JB 8|  JD$$ X8|  P ],@ H ., PP8|  P<| %@<%8| (| P9,| `| 9 $ D$_  H| u0| DX| D$$_,|  D`| $ D$_8|  P P<| R<PP8| @^ 8|  A$58| F RF p| $D$BD$ $J~8|  JJ 8|  JD$$VFN 8|  ,FV뜁F : 58|  |$\$$M8|  J  JJ 8|  JD$$V>)S$:@| ;L|  r0| 9s =| 9s  a={ | ? :  ΋ %PF  F 8| F %PL с҉N  58| V  ,V    $T$[ 58|  F 58| $ D$[F58| l| %d|  T$$6\  H| u0| DX| D$$[,|  D`| $ D$[@| ;L|  ;0|   ^8|   ., PP8|  P # $@H6Z8| 8|  =  %DL$ $&Zo\Z8| 8|   %@T$ $Y2Z58| = 58|   RD$ $YV 58| ^<|  ! $ 胉7cv6&zjZJ58|  +@| < 58|  P@|   T$$X@| $멡@| 58| L   P@| kD$$ QM8| )؍9,| `| 9 $ D$X  H| u0| DX| D$$aX,|  D`| $ D$>X8| ؍ځۉP5 @  ,PP8|  P %@t&  $T$yV28| P9,| `| 9p $ D$W  H| u0| DX| D$$QW,|  D`| $ D$.W8|  P , PP8|  P %@ $38| P9,| `| 9 $ D$V  H| u0| DX| D$$jV,|  D`| $ D$GV8|  P  ,8| 9,| `| 9 $ D$U  H| u0| DX| D$$U,|  D`| $ D$U8|    ,PP8|  P %y8| P9,| `| 9 $ D$(U  H| u0| DX| D$$T,|  D`| $ D$T8|  P  , PP8|  P %8| P9,| `| 9+ $ D$NT  H| u0| DX| D$$ T,|  D`| $ D$S8|  P ,!D$$K 58|   $$D$D$ $.?8|  9,| `| 9 $ D$+S  H| u0| DX| D$$R,|  D`| $ D$R8|  P  A,PP8|  P # $`?8| P9,| `| 9' $ D$JR  H| u0| DX| D$$R,|  D`| $ D$Q8|  P ,@,$ SL58|  <| %@<%h 95,| `| 9< $ D$_Q  H| u0| DX| D$$Q,|  D`| $ D$P8|  (| P<| R<RPP8| @"t&P;,| 8| H`| 9Q $ D$tP  H| u0| DX| D$$2P,|  D`| $ D$PjP ], @8|  PD$$3 G  $ D$O  H| u0| DX| D$$cO,|  D`| $ D$@O| }r58| 58| %d| w| ؍,a P  ,PP8|  P %DD$$FV 58| ? { ? ${ 58| $ M58| BΣ %x4F9,| `| 9 $ D$M  H| u0| DX| D$$M,|  D`| $ D$M58| F^~8| F$  %58| F  ,F  %@`   ,B BB ., Z8|  B # $9E8|     ,HD$8t$0l$\|$`|$@Dl$4 D$X1fT9ul$\T$@|$`tl$X…ۉ8| .n~1Dȃ9ul+|$0~+1ې40Ɓ9pul8| E q$L$ L$$T$:c 8|  QY  , Q Q ., AA8|  A # $+8J58| = [)$] QF $ D$Gz$ 'F(L$R%Í&8| u$Z<% Ãt$d;t&8| u$Z<% Ãt$$;t&8| u$Z<% Ãt$:t&8| u(Ru,T$$Z<% Ãt$:t$:8| u(Ru,T$$B[<% Ãt$2:t$!:8| u(Ru,D$$Z<% Ãt$9t$98| uRu!T$$[Ãt$}9t$l98| uRu!T$$b]Ãt$9t$ 98| uRu!T$$^Ãt$8t$88| uRu!T$$gÃt$]8t$L88| uRu!T$$bhÃt$7t$78| uRu!T$$hÃt$7t$78| uRu!T$$biÃt$=7t$,78| uRu!T$$iÃt$6t$68| uRu!T$$RjÃt$}6t$l68| uRu!T$$jÃt$6t$ 68| uRu!T$$RkÃt$5t$58| uRu!T$$kÃt$]5t$L58| uRu!T$$RlÃt$4t$48| uRu!T$$lÃt$4t$48| u $$VÃt$O4 8| u $WÃt$4 8| u $DYÃt$3 8| u $D_Ãt$3 8| u $_Ãt$O3 8| u $`Ãt$3 8| u $4aÃt$2 8| u $bÃt$2 ,8| uERuUL$L$ L$L$T$$RYu)D$D$D$$*,Ãt$2$92t$1&8| u!Ru1T$$ZtÃt$1$1t$18| u!Ru1T$$[tÃt$91$]1t$18| u Ív1tÍ&',8| \$ t$$|$(?D$$3D$uaD$$豵t(_t&؍؍1\$ t$$|$(,Ðt&D$6$Ptlj$ϲ$n\$ t$$|$(,Í&5-jD$D$t( R8 L|$D$ fD$l$T$l$D$% h9*n$h/$/S$3$2\$$h[ÐS$2$2\$$6h[Ð8| u#$2D$8| $OhÃt$.v'8| uH@tuS$"t:hÍt&u&%D$ $XiÃt$3.$W.$.t&'VS48| D$,$19D$,1uou[uT%9vWB= uš8| @\$ $D$@D$D$,D$5$}H4[^$;-$_-$S-8|  EÐt&S@| L| 9r0| 9 H G 99s$Κ !k$ t& $ D$;  H| u0| DX| D$$;,|  D`| $ D$c;@| +G | ,H9.T$ T$$ @| P [$ Tj$ &8| PT$$Ív8| u %$+t&8| u %@$T+t&8| uR% $+8| uR%P $*t&'S8| $,)f[~ut[$v*8| 1ufRt u h$%*t&8| @t'&Bu9 uÍv= u1$)&S8| @t>Bu+u%9uӃ[Í= u1[$N)&'8| $苖 EЃÐt&S@| L| 9r0| 9 J G 99s$Κ 1g$ t& $ D$7  H| u0| DX| D$$7,|  D`| $ D$s7@| +G | (J9.D$$D$( @| BD$ [ $ `f$ t&SD$@$+É$u 8| PT$@$D$[$''8| $˔u8| %$H'&8| $苔u8| %@$'&8| $Ku8| P% $&8| $ u8| P%P $&,8| tuXRu:L$L$T$$&!tt $&t& &vD$,Ãt$%$%v,8| tuXRu:L$L$T$$ tt $%t&%vD$,Ãt$%$s%vS(8| tuaHuC\$\$ @L$$D$"tt $$t&%vD$([Ãt$$$$v'S8| tu]Hu?@L$$D$"tt $u$t&{$v8| @[Ãt$j$$^$&',8| tRusL$T$L$$Pv $#f$ؤ h,Í&h,Í&h,Í&h,Í&#t$#$#,8| turRuTL$L$T$$Ft)~/tt$#t&ȃ,Í&D$,Ãu#t$#$"',8| tuXRu:L$L$T$$Vtt $"t&"vD$,Ãt$"$s"v,8| tuXRu:L$L$T$$ftt $"t& "vD$,Ãt$!$!v,8| T$T$PT$$tt $!t&!vD$,Ð&S8| tuvHtuY@u;D$ L$D$$E#tt $#!v+!v [Ãt$!$!$!t&VS8| tXuXHtui@ uKD$ L$\$$"tt $q { v [^Ãt$l t$[ $O $C v,8| tuXRu:L$L$T$$%tt $t&vD$,Ãt$$\$ t$|$l$tȋ\$ t$|$l$Ð$R uρz Z \$tZ1\$Z9 tf9tՃ9 u9v9L$$US T$h:R&T$T$ًl$1뫍vVS1uoZRfu%сu@Qtۋ It&Rt[^Ít&QY땐t&rRe'WVSrDB%x@ui%%X@u$%uABt܋%RtH@t[^_f@L$4$%D$%X@vx@It&\$Ӌ@| ;L| t$Ή|$xr 0| 9rb uiD$D$$1ً|$IZ\$JB ht$Í&9s t $ D$+  H| u0| DX| D$$+,|  D`| $ D$c+\$=| t$|$Ð&V%S˃@L$ %tSRuE%;up@u$f%u@tރ[^É$t ,t&%@%@u9u%묐9t%v,t$ Ƌ\$|$$l$(2@| L| 9 J 9 B B > @|  Bz ׁ9Bz@| ! Z a ȁBhJ@| \$t$ |$$l$(,Ív0| 9DJ 9I4v-0| 9WB9\ BL& $ D$0)  H| u0| DX| D$$(,|  D`| $ D$(| &=0| 9Z 9f% 7!& $ D$X(  H| u0| DX| D$$(,|  D`| $ D$'| @ U%WVSӃ@L$0%1tnvR%;uލx@1퍶u$%u)Bt1tto[^_]Ðt&$0t  Z uJȋ|$rt$@| \$BQvZ 9s Z tt& $ D$0#  H| u0| DX| D$$",|  D`| $ D$"| $8 Q$ 'SÁSJtKu[fC[vRuڋ[u[,҉\$Ét$ Ή|$$׉l$(l$0#D1%x؉l$4$؉l$4$؉l$4$A%PiuOفA%PtDqtA/\$t$ |$$l$(,ÍA롋@uyuw붐t&@kAgO[f1҉,$غ,$؉,$($8  P$ UWVSÃ,7l$@21OAI <| 5@| 9QD;5L| r ;50|  WB GBjuw%%p@t&u(%Bt؋E%R@Et,[^_]á<| %pGG%h@?T$.T$D 90| f@L$\$%D$ $R%p@&h@% v%t4#,[^_]á $ D$x  H| u0| DX| D$$6,|  D`| $ D$G%D| ,[^_]ËBjWG%h@t vv,[^_]á<| %9PDЉ$8 L$ ? $t$|$|$l$ 2tVt6 <| 9QDщ$t$|$l$ Ív<| [빍&ށ v. v 4믐t&$X r듐F$|$t$|$l$ fB`UWVSÁku E<9s#u9uq09td9wE%%@%h%|19s(u= f9v);u)D8t[^_]Ðt&[F^_][1^_]É t&9v;u)Dȍv'UWVSЃ%ӉL$D$5t&D$F%puʼnE |%%@%P$%L9s|$ v9v;u)D8t|$ eL$tT$2[^_]f1ɉډ%/1ԍUWVSӃJL$T%hG% t4t&I%;uދPXtIZR4%uى0T$P%h%PG_%PbGtG|$TD$Pt$,$D$<[^_]Ív`9  $ D$  H| u0| DX| D$$v,|  D`| $ D$S| <[^_]Ít&@| ;L|  PL$P0@| hH D$ $|$Tt_tt&$(v@Gf 0| 9cP9hSL$Pt$l$L$ $<[^_]fT$Pt$E,$T$-<[^_]Í|$,& $ D$  H| D$$,|  D`| $ D$| $8 E$ |t& @| ; L|  AD$D$P1 hAD$ܣ@| T$ $D$ D$$D$L$L$$T$0| DX| 0| 9D$iA9D$D$lS $ D$  H| u0| DX| D$$,|  D`| $ D$\| $8 D$ *t&S1¸t2t[́ v  w$ܥ  t24[Ð[Í&B%2t[Ív[Ð[Ðс v Uzɰu[É[ÍSD$T$ L$tt [Ítu[vt$t$ $T$\$tt$t$Ít&t u݉ى{uϡ<| %@빃t$t$\$T$ \$$tt\$t$ft uލL$ tu \$t$t$\$Ít$t$\$T$ \$$tt\$t$ft uލL$ yt$~9tu\$t$Ð \$t$Ãuft$t$\$T$ \$$tt\$t$ft uލL$ | \$t$Ãuut$\$Ív' |$|$$T$t$\$t$t(t$tt$t$|$ Ð1ɉt#ى$t$|$D$ t&$t$|$ ÍL\$<\$Pt$@t$T|$D|$Xl$Ht7t3\$\$t$|$ft$|$\$t$É<$0$ 0 1$UWVS,\$Dt$@|$H,3,$AdŅH| -| [ | \| T|   | L| @| F =F 5F 4| | `| -X| 0| uDʼnD$$,|  D`| $ D$| 8| `|  @ ,| H| u0| DX| D$$X,|  D`| $ D$54$D$D$ D$@| D$L| K,[^_]$l 9.$ -.(/$$@ . /$$ -.$rfÍ&'T$ DСF D$D$ЋH| 9| Í'SD$$\$ , ًH| 4| F | `| | \| T|   | L| @| |  X|  0| uDЉT$$,|  D`| $ D$| 8| `|  @ ,| H| u0| DX| D$$;,|  D`| D$ D$$[vD$ $[1t;L| r ;X| Ít&IF <| $Ol|  $tOX{ | D$8| $IT| D$\| $IF D$$iJSUWVS,DID$$OF =G @| F @<| %l|  | `D$`w51 vQ9s)ы 9ws 9r ;L| r0| 9I=| $``w<1 P9s)Ћ 9w89r D$D$$  | | D$$ G D$$ |  $ D$  H| u0| DX| D$$,|  D`| $ D$r,[^_]f| D| t&t$L 9=| čt&[)v+DxuDhtǍ=wu,9tt&D$ T$ 9T$,=L$8L$0|$ 9|$,l$09l$<l$4;-d{ v ;-p{ l$4$`{ l$l$0  Eu El$0 $NjD$05F -{ $ƒ8ED$0-{ D$0D$<+D$0l$0{ -{ t)^t&$Fu4$F-F  D_$1Ҁ|/)֍F$!F39ӉD$Cыt$)L$|$ L$(D$ D$ ރt$ L$9΍K9L$ ΉL$  t$1L$(T$9wL$T$9|$tCt&9‰w|$+T$ DD$$D$D$ t&ts:\uCu1t&tX\uPXu $Dlj tEM\uEu1t&D$$9D$"|$ Fl$89l$/{ D$ 9 t$$8 D$r]$ a[^_]ûf 델$ Ņ| D@F D$9 $ D$4$dtg=F 4$+$:t$lj$2$* E؀;/$uڸ9 1ɉ9 { D$ 9 D$ $ D$T?l$ D$ { $ D$.F $ D${ D$ L$\$ D$ 묉t$ D$ 랋T$({ $ T$D$诳D$$au&{ D$ 9 \$$d D$u$$r9\$lj$q$ $ $ $2$?q Í&' $ D$  H| u0| DX| D$$T,|  D`| $ D$1Í' $ D$  H| u0| DX| D$$,|  D`| $ D$Í $ @D$  H| u0| DX| D$$S,|  D`| $ D$0Í $ D$  H| u0| DX| D$$,|  D`| $ D$Í # fÍt&' # fu $t& Ív'D$ $D$H  H| u0| DX| D$$,|  D`| $ D$ S\$ D$ $$0$D$B p\$ [3vD$D$顺=F D$tÐF FF t$׾F gD$ T$$t-s&D$(D$ ? T$D$$Ðu!D$(D$ ? T$D$$Í&'D$ T$$L$(t)s"? L$ T$D$$MÐu? L$ T$D$$&fD$trtÍ? D$jf? D$Zv'D$$D$ D$ D$D$? $Ít&D$$D$ D$ D$D$? $Ít&D$$D$ D$ D$D$? $XÍt&D$$D$D$ D$ D$? $(Ít&? $ÍD$$D$D$ D$ D$? $Ít&? $0ÍD$$D$D$ D$ D$? $Ít&? $Ð8|  hS8| XD$@$` 9øEЃ[Í&8| %$YÐt&8| %$9Ðt&D$$$Í'$a$Ðt&D$$ hÃD$@$y8| R Ð8|  J9 EÍ&SD$@$(D$$ É[Í8| $Ív'$qÍ'$8| Í$a8| J  Ít&8|  hÃ8| ${+% hÍ'D$@$ $A+% hÍvS8| XD$@$ 9øEЃ[Í&8| %$9Ðt&\$t$|$D$@$mơ8| x4$*t5u \$t$ |$Ív$c*9t$#v8|  J9 EÍ&8| 8% Ë8|  : EÍS@| L| 9r0| 9 H G 99s$Κ $ et& $ D$h  H| u0| DX| D$$&,|  D`| $ D$@| +G | 註H9.8|  ؉ @| [$ $ 蛧t&'8|  6EÐt&8| 6u %$%t&8| 6uR% $$3豺<\$,áF |$4t$0։l$8t&F  F F F  `T$Lt&=F <|$D2=F Z&UWVS1ۃ l$$vD$ |4t/t9|*9~Ӄ [^_]Í [^_]Ð [^_]ÍvVS$? F iF ? D$D$F $? ңF 41P1ۋ-F Lt $T$T$9u΃,[^_]Ít&VSt$T$Ft1fF:9^w[^Í'UWV1S=F t4-F 1ېt&Tt${9uك[^_] SF D$t1ۍt&‰9F w[ UWVSl$4\$0t^1v{D$D$5-jD$ %$Cu"T$8C%9\u[^_]$6諮\$t$t$ $!É01t 4$!Ct$؋\$ S\$ t C$7!\$ [*!v'S1T$$\$ ҉tT$C$ C[fWVS|$ 7$h É0u@[^_4$E CW9s 9w[^_Ð1\$\$ t$3V҉tT$C$" T$$C\$t$ÍSD$\$ P 19s 9tB9t9w1[Í&[É'SD$L$PD$ T$9؋RsL$ 9w[Ð&VSD$ T$L$t$@v9s)L$t&9É r[^ÐVSF`| 9t $ђ 8| X| +L| $D$H8|  ? g 4| `| 9uT| $ $ 4$D${  $# T| 5 | 5L| pX| +L| $8| 9,| `| 9t $] y $ D$q  H| u0| DX| D$$/,|  D`| $ D$ @| h;L|   ,r 0| 9D$$ }8|  BB8|  B<| ? n %X09,| `| 9 $ D$h  H| u0| DX| D$$&,|  D`| $ D$8| PX8| @$OI$CI)ы| 9) h8| Ð&8| $.1҅t;\| r; | ҁ ЃÍ1Í'D$ $1t;\| r ; | Ít&VST|  | \$$L$ )9r649s)9wTT| [^$| $衔$D$|$T$ l$ |$$l$\$,t$L$0t$(׉(l$9D9Dhl$ x |$pt$X$PHÐt&U1W1VS$,$4t&uT$$$$T$$0D$T$ 9$(?WvD$D$[^_]$ ;$(ti9$(v l$ 11҃t`L9t 3u$9T$tL$y9$(L$eD$D$[^_]Ðt&L9t0u9$(& l$ 11҃uB&_L9u 305L9uދ|$ 11҃t) t 3uv t0u|$ 11҃uA u 30} u9$(D$W 11fuD$V9$(W 9$(WoL9$(t<1҅t7t[ft уr 9u݁tCvu~9tʉt уrߐt&uB9$(o/9$(1҅t7t&4уs 9u94уs1Ʌۺu=  u v u W9$(WOʍ|9$$9$(D$9$(?W9$(W|9$$o9$(b$9T$L$ʃ;yEщT$(t&ۺ tS L$ɹEL$L$~9$(W 9$(Vu9$(WtW9$(WO9$$9$(sL$L$LT$XT$D$T$&v'UWVS$$$R[6T$,$\$4t$0j$T$`1t$4׹ 󫍔$+t$,t$8 󫋔$9$QT$,$$D$D؃l$@T$Lf>nv t$ļ[^_]f$ V9$vʍVNT$<VʋL$8t݋D$<\$P.RD$<\$Pt$XD$H\$PD$H8RRDV/1҉ŋD$H)ЅD$XD$P 8L$Xtى&1҉ŋD$<)Ѕ~TD$XD$P 8L$Xtɍ&1ҋL$PD$H t&9T$D$FT$4$||$D$ D$4T$8$D$D$0T$,$tT$,n"99|9Xu&9@h|LtT$8L$,\$D$T$ T$4t$T$T$0$)L$,tt$Le3 \[^_]9^Xz\$<Љ 9h|LtT$FP$3Ĭ[^_]É u$;uvtttut&Ĭ1[^_]Ív$4u$t$t$t$u$t$tUWVS8| T$,[P2RP P t% X $u$uD$NjC$)K ŋC%@ D$(C %P 9~ C%999YD$(%9ƉD$([T$8| T$(L$\$$T$l$ P  NT$@$%D$ 8| 1T$4I \$|$t$ɋL$,E‰D$ AQ$%ЉD$8| r L$41t $L8| FL$\1r t $'8| F,L$81r t $8| FL$`1r t $݈8| F0L$<1r t $踈8| F L$d1r t $蓈8| F4L$@1r t $n8| FL$h1r t $I8| F8L$D1r t $$8| FL$l1r t $8| F9͉\$ )σ9FQT$$L$tʐ)9w9T$+t$$)t$$4t$(tv1͉1Ɉڊt$ ӉT$ T$,T$ t$, ֋T$ft9wt$(9t$$T$tt&9wL [^_]$nAT$$\AUWVS$| u uƒ   h[^Ívà t u@u@뻍t&{ 뢍ve뎍&K o 5 [t&Ā̀Ct& '  Ā̀  ƒS 0v$=&8|  uI%%=u6$ 8| %D@  $<&UWVS, 8|  %=I D$AT$L$$ $>$\ >L$T$y tAI%9L$ G9G19vBj1&9sBR;D$LD׃ vڀ% ,[^_]$r;$f;UWVS<8|  %D$,%=Z D$C$$D$$<$D$$D$ <|$$sNjC t$$%D$$D$CT$%D$(D$ D$(9T$ FD$ D$ D$(9G9|$ l$,T$ 9DD$T$9s01 f9vH@9TD$E vڄuCT$Dƒtt';t$t9|$t?L$L$ fL$L$ dL$ D$ +D$(9L$C+D$$<[^ h_]ËD$D$ +D$(9T$C+D$$<[^ h_]ËD$ T$ $9$9 UWVS<8|  %D$,%=mZ PD$C$$D$$:$D$$D$ :l$$s ŋCt$$%D$(C%D$$D$D$ D$(9t$ BD$ D$ D$(9C9l$ sn|$,L$ ƒttzD$ 9t$ tb9l$ t5vҋD$ 1 f9vH@;L$Dƃ vۄtD$ +D$(;t$ CD$ +D$$<[^ h_]Ðt&T$T$ X+D$(9C+D$$<[^ h_]$7$7 UWVS,8| 2 %=z D$G$1$D$A9\$$/9O WoD$L$T$9ˉT$+C9ȍ(C9s~t9t9r,1[^_]f\$f)9C+D$,[^ h_]$6$6&'UWVS, 8|  %=q D$FT$$$D$ 8\$$7~ nL$vT$|$+t$9C9)C19sQBv9s\9Dދu9su 9t%9w)9C+D$ h,[^_]Í&뾍t&,1[^_]$:5$.5&'UWVS,8| : %=r D$F$$D$6\$$6T$On ‹Fvl$%D$t$9G؋D$9G19w Z9v\C{9D݋uv9sCu 9u9r+D$9C+D$ h,[^_]Ít&,1[^_]$3$3&'UWVSL 8| )  E%=Q D$BT$$<$D$0L5\$0$:5T$|$0r JNjB$t$0%D$0L$4D$9C؉9C(4NȉD$,8| L$8@D$>9UD$?&9D\$D$= L$ W9VсE+, l$( l$V|$l$$ՁD$(El$$!t{9D\$9v\̓ L$ 9D\$ u t9s# L$ tȃ9D\$91L[^_]Í&u|$ l$=wԋD$ $ 9v̓9D\$9w 뽍9s9V9D\$ w뷐9s9D\$L$,e|$>Z9vjr\v wO9D\$919uȋ\$t&l$,t$D$,9D$8D$,+D$49C+D$0 ht&|$>9s 9|$?l$,tD$,9D$8D$?t&ŁɀVՁjvD$,9D\$1|$>&5fD$,(D$? 9D\$F$/$/UWVSL8| z|$8: %=Z D$C$$D$, 1$D$,D$0Ss [D$,D$D$t$,\$,T$09t$FD$$D$D$9t$FD$D$/NЉD$$8| T$4T$@D$>9T$OD$?T$9ډD9D$T$sx1 t&9D$sx@9ߋDƃ vۉtED$;\$Dƃ9DƉD$D$$u |$>|$9|$r1L[^_]Í&T$|$;\$RD|$‹T$=D$  D$#T$9T$=|$9߉D9‰|$(s61 v9D$sx@9ߋDƃ vۉT$ |$ $VҁD$ EG, V%E!T$(;\$(D։T$|$9|$WʼnNjD$0l$9Dƃ ;D$ Pt҉ l$tǃ9DƉD$gfD$=|$D$ QT$$ |$>;T$9T$v|$G;D$ u 9D|$|$?_l$$t#D$$9D$4D$?D$$D$+D$0;t$CD$+D$, hl$$tڋD$$9D$4t& l$D$D$8D$ % ҀV%D$ trj@v|$͋D$t$f9/ލ9D$DD$9s01 f9sH@9TD$E vڄu T$;D$ t6;t$t9|$D$뛍vD$뀃D$$D$?D$$׋t$;\$D|$w|$>l+D$09C+D$, h_T$~͉|$ 9T$TT$ߍv9D9D$T$s\1 9D$sH@9TDƃ vڄt.D$;|$DD$ D$;|$t9T$9T$rt&T$BDwD$D$;|$uljt$K+D$09C+D$, h~$I)$=)'UWVS8|   %D$4%= R  D$BT$$$*$\*T$J zRt$;9C9΍>T$8CL$)L$D$dD$T8| P@T$P $ %  PT$ T$D$jT$@P҉T$t8T$ D$ T$ T$P hh6hJ hV h:h h= D$DUD$\ut&D$ D$<D$DD$\D$D$@@| L| T$L9‰D$r0| 9T$LsD$L$9sEt& t7G 9T$ 9T$L $Κ e$ t&D$8%|$\D$~|$\c|$\|$ =|$JT$`T$0T$`T$HT$899D$D$4D$L&9p9T$pT$L9D\$ wt&@D$<D$DD$\D$ $ D$4  H| u0| DX| D$$4,|  D`| $ D$c4@| +G  | %T$`|$D$ T$0T$`T$HT$8t9T$8RD$ T$5&D$DD$\P@$T$ >T$D|$D9D$C$?/C$ C $C$$C($C,$C0$C4$C8$?C<$C@[^Í'D$ T$$?~D$D$ $BË ` t݉L$ D$D$ $AÐ$8 QC$t&,8| |$$=,| t$ \$p9l$(`| с9   -H| ˉ tRE׉-  h\$ E,|$$ l$(H 58| t$ P,Ít&-0| D-X| 뜍 $] $t&U1WVS,t$@uyuo ue@u[ƀuQuG u= u3 u) u u@u <|  %XP %9 4= t-  | +8| -  d| 8| ,| X9 hH phH8| @H| = = u0| DX| D`|   ,[^_]Ít&. `| ́9)-  - R%9|t L$<$L$<$$L$Ǹ!$` ?x$ ?e$] n&'S F ځt 8| (t[Ív ߍAY8| Qz $dt& 8|  HP 8|  F Jt_H'8|  ,  P@8|  P   Ív 떐t&D$ $豟$衟 T$  w $}' T$  w` $M'$ 1D$  H t$ %t1ҁxhƒ D$D$$ L$ hJL$$BhH hJ $臞&D$ $aT$$T$$8| t$t$ \$\u $vt!\$ t$\$tۉ4$q4$'8| t$t$ \$\u $t!\$ t$\$tۉ4$4$9'8| t$t$ \$\u,$t$x \$t$É4$tω4$t&VS8| t$ \u1$\t$9D$$~u[^É4$tʉ4$F,8| \$\$0l$(t$ t$8|$$|$4luE,$Vt1,$9|%9fvu\$t$ |$$l$(,É$t$8| t$t$ \$\u4$ft $9D$(~9D$$ \$t$É4$tlj4$M'8| t$t$ \$\u $ft!\$ t$\$tۉ4$4$'8| t$t$ \$\u.$t$J9D$$v \$t$É4$t͉4$v8| t$t$ \$\u4$t $9D$(v9D$$w \$t$É4$Ztlj4$'L$ ttÐL$ $t&D$D$ $̐D$ tt*%@Í5-jD$ D$ fD$ 4}t&,8| t$(t$0\$$\t6t1$xt$(C\$$,Ívtt΃tAuԍt&"D$D$$t4\$0t$(\$$,|t$(j\$\$$D$,É4$4$&S8D$D\$@D$L\$(\$$D$wD$(w 8[؉$y'S(D$0 v1([Í&At ([Åy,%D$D$$G1uD$([Ðt% UWVS,8| T$D,| t$@ɃL9va `| ρ99%= - l$-H| |$= u-0| D$D-X| D$- Eˉ uH PA,  PP8|  P<|  t$  @,붐t&%P  uρ%9TT$ = | +8|  = d| 8|  ,| C9  hCFC8| 4$ C8| T$PP8| @X|   `|  ,[^_]Í&RT$+t&`|  9uU=  -H| lj= u-0| D-X| Eщ-  $t&H S>$] n &'<| d|  tG@| P HH с@HH@| l| Í&%PPtl| Í&@| сB JJ BJJ@| Ít&,8| t$ 5,| \$|$$X9މl$(vK`| с9  = -H|  E։-  @d| L$0t$ |$$hl$(Pl| ,  P 8| \$P<| %@P%l| ,Ív-0| D-X| ^$]  t&U1WVS5@|  T$$;5L| w 0| 9i)X| D$ 1DӁT$T$ D$ D$ Z\$C% ЉFF ;$A5 <$>EF EFUFӁ9tI~$ &$ ÉxZXR Ӂ9uȋ> ߋ${\$SӁ9T$T$tvtv@| D$ H% É^\$S ɉPtSl| [^_]Ðt&;5L| r X| 9t[^_]f@| 1[^_]Ë$1@| 1볃 \$ t$5 | +8|  \$5 t$d|  É'l| T$@%l| H%PT$HÍt&'l| T$%PT$H l| %@% T$`PT$Íl| `@%l| Íl| @%l| H%H@),Ít&'l| %@% @),`ÍT$D$ ËT$D$ UWVS,=@| D$8| T$TG@| !L| 0ɋ50| 9r9r  uG*(Rtң@|  D$,[^ _]ÍG @| 99v$Κ ].$  $ D$  H| u0| DX| D$$,|  D`| $ D$@| +G | K1D$$H$ -$ PUWVSӃ@| 5L| 9r 0| 9r3 t5G 99sy$Κ U-$ )ݍ,9r%փD9sf Jс9؉JwB@| B [^_]Ð $ D$  H| u0| DX| D$$^,|  D`| )$ D$9@| +G x| $ R,$ SÃG ;L| ;@|  $ T$  H| u0| DX| D$$,|  D`| $ D$n@| +G D| $Κ +$ ($ l+$ $\$T$t$t$D$  T ȉt$$Í&VS@| |$(\$$L| 9  G 99 $ D$  H| u0| DX| D$$L,|  D`| $ D$)@| +G D| t& 0| 9At95 D@| D$ [^ Í&$Κ )$ $ )$ S@| |$D$t3;L| s t"et& 0| 9s\9rۍD@| D$[ WVS @| |$(\$ t$$L| 9 G 99 $ D$  H| u0| DX| D$$,|  D`| $ D$d@| +G D| 0| 9F|9: (ۍy=@| t1҉t9u@| [^_Ðt&$Κ $($ $  ($ WVS8| X$v @| ơL| 9r 0| 9r3 t2G 99sX$Κ '$ H|9rʼn (y1=@| t1҉\9u@| [^_Ðt& $ D$  H| u0| DX| D$$,|  D`| $ D$@| +G D| O$ &$ g&@| ;L| \$ t$|$l$r 0| 9r t0\9r Ћ58| T (@|  <9tʼnу)9׉\)u\$ t$|$l$Ív,|$$= \$t$ l$(@| ;L| r 0| 9r tL9r58| Љ: T:@| 9tʼnt&у)9׉\)u\$t$ |$$l$(,$ 8|   EÐt&8|  >EÐt&8| $S EЃÐt&8|  u%%$$8&8| >u%%$$&8| $;Su8| %%${$t&'S8|  u&$%D$D[$Y'S8| >u&$%D$~D[$ 'S8| $JRu-8| $%D$!D[$8| \$t$ u5p$%D$t \$t$$Cv8| \$t$>u5p$%D$dt \$t$$vVS8| $)Qu68| p$%D$t [^$fVS8|  uj$^$Pځ909 u [^Ív[^$<$0$t&VS8| $9Put8| $$ځ939#u [^Í[^H$$$Tt& SD$@$HÉ$~Ou[Y$-'UWVS8| ( $$á8| p  $U9z9jڋ)Ё9F~)LB\Ӎ&u [^_]$!$E$9$-$UWVS8| ( $$á8| x  $U9i9Y) 96~L1tf9u [^_]$2$V$J$>$fVS8| 0 u_$$8| J 9B92)؅~\1Ґt& 9u [^$$$D$@Ít&D$H PÍ&'D$D$ $ª t&',D$D$ pB D$D$$H 1p| H ,É',D$$H D$D$ pB D$D$$H p| H ,|t$\$|$ H t$ H ȃ)9aH ϋH !¡H ։H ))9~ H ʡp| H p| Ct$\$|$Ít&t$$H H  H f$ AH T$ H PT$$PfD$ \$t$ $p É4$T$$H st$H D$(C\$Í&VSt$ p| 9t  t&9uf9t:ft{C9H tK;H p| v$;H sH H 9uƃ[^\$$H p| 裿C $SU;p| uCH 됸   t&S\$ $H H P @PH H P PD$$[ÐS(8| u]D$$`8| T$D$T$$8| D$D$$C( [$dt&8`$T$7ÍvSH8|  % D$D$$T$T$$_D$0$)CD$,$C D$($ CD$$$CD$ $CD$$CD$4$T$8C 1x$*T$C [$_$SvS8| B7u@u@%$c8| Z$C [$$vS8| B7u@u@%$c8| Z$^C [$$svS8| B7u@u@%$_c8| Z$C [$$v8| u%$a$$t&8| u%$a$T$t&8| u%$a$$Dt&8| u%$a$$t&8| u%$a$$t&$a $b$T$É'$1 $b$T$]É't$|$D$D$$$׉t$|$$b t$|$Ð&t$|$D$D$$$׉yt$|$$b t$|$Ð8| u2%$|dt%hÍt&0$N&'8| u2%$dt%hÍt&0$&'8| u*%$,et$Ív1$8| u*%$et$Ív1$FD$$8| u%D$$i% $8| u %$g% $8| u %$ ht$o$`8| u%$i $'&8| u%$ i $&8| Bu2u2%D$$i $$8| Bu2u2%D$$h $,$ 8| Bu2u2%D$$h $$S8| ueHuL@uL$$Yh [Í&L$$g [$F$:v'UWVS< $T e$, 1$P t$l$,|$|!D$ l$,D$&T$l$T$$X $]t~W$\ D$l$$t9<)׃|w~t$|$뜍t&|w1 t&$, e3u,< [^_]Ã-1؍v L,*v'8| Bu2u2%D$$!g $$8| u%$\h $g&8| u%$\h $'&8| u%%$Lh|% $$ 8| u%$j$T$t&S$0É$6jt$:l [$tt&S$É$it$jk1t$Zj[$)'VS8| XuA$Ɖ$it3\$4$*kt$i[^$$S\$$$0;|| s[É$[t&'t$t$ \$4$;|| s$nt؋t$\$É4$ 4$5t&S$;|| s$>nt$Rn [$S$`;|| s$mt$n [$l$UWVS<|| D$,t`1$t&T$,l{ D$,9|| D$,v8$xmtl{ P9p{ sD$$`{ l{ 멐l{ -h{ D$)x{  d{ !Ћp{ )ˣl{ )9}t$h{ D$$ D$%X49s)ǐD;$9w;-d{ v;-p{ r3l$$`{ 3D$<[^_]Í&l{ vv-h{ D$-l{ <[^_]Ð&S$;|| s!$.lt!$Rn$z[$$'S$@;|| sF$kt.$m1tv[Ë $f[$`$$t&@=kJ=kD$,D$ƉËD$$HCD$$SC<$SC 趡\$ t$$|$(,Ít&\$t$$9$É$Zut$$ \$t$$#vS$É$fZu$ [$vS$PÉ$&Zu$ [$裱vS$É$Yu$ [$cvS$É$Yu$ [$#vS$É$fYu$ [$vS$PÉ$&Yu$ [$裰t$t$ \$4$ É$XPw؋t$\$à t4$\S$É$XPw$膻$[à t$&S$pÉ$FXPw$覻$^[à t$踯&\$t$$Y$ É$WPwt$$譻 \$t$à t$Kt&'\$t$$$É$qWPwt$$ \$t$à t$ۮt&'$聼$詼$AÍ'$a$yx $ $m'VS&$N$É$VPw%D$$[^à t$ VS8| puP^蛿9uU$5É$ VPw&t$$Ŀ [^$M t$l$`S$É$UPw$ƿ% [à t$t&S$É$VUPw$ [à t$ˬt&'S$0É$UPw$F [à t${t&'S$É$TPw$% [à t$$t&S$É$fTPw$ [à t$۫t&'S$@É$TPw$ [à t$苫t&'S$É$SPw$6 [à t$;t&'S$É$vSPw$& [à t$t&'S$PÉ$&SPw$ [à t$蛪t&' ( % Ð&  % Ðh$ÍX$ÍH$ÍH$pÍH$JÍ8$JÍ($ É',D$$(D$$,Ð,$QD$D$$( ,Ð&UWVS(Í$H((ۉt#1ҁDQDDQ 9u[^_]ÍWVS%(.((ǡ8| uOA%9u:t1ҐDQDQ 9u4$ (<$q( [^_$ 8| BuLu4%D$$x $uÐ1$螧$蒧f$A$$Í'$ÍUWVS,8| %$贩D$ljurfƋFu)D$D$$ vD$]9s7D$l$%ōD$D$$ G)9*rD$,[^_]$x&\$t$1.t$G$&\$t$Ð&8| \$t$u8%1$肩t$DG$\$t$$Х8| \$t$u8%1$rt$F$j\$t$$pS$OE%$}[ÍSǧ$E%$][Í8| t$\$|$p7uw$ǡ8| up%XS9uM8| |$%$8$P\$|$F t$$l$萤$Tt&S8| X7u7u7%$h$кC [$$t&'VSD$D$$?$qÉ$7Lt $*Lut$$ [^$袣fVS8| @7un֨ߥ$É$m$1\$4$D$$4$8| X4$C [^$X$萹Ít$\$|$$襤ơ8| @uh%X9ui8| x$fÉ$Ju:t$|$$ \$t$|$$$A$5t&S$É$vJu$詨 [$vVS8| @7$蛣É$!J8| 1ҋ@uBT$D$$v1҃t8| Z$ C[^ÉuB%p豣9u78| P$($$$t| Ðt&t| Ðt&\$p| t$Z$Nǀt| $t| D$;\$t$Í't| 1tu ǂÍt| D$$U,8| u$萝S(e$1\$t&$t D$$脤x$h1t $>$e3u([9'S(e$1\$t&$ D$$x$>$e3u([ˡt&'S8| t#t(u:%$[Ðt&$谳t$$|[$kt&' hUWVST$89T$4w4t&4$`t# u;|$4l$8|$(vf\$(4$܏D$,D$D$D$D$ "D$\$$$ 9t$,w =v:\$4$襖$ p$ $衒 T$|e3 Č[^_]Ël$49l$,Cl$,[\$(4$ *\$(4$D$D$D$D$ 2D$\$,$F"vvt$\$$\ #D$D$D$D$ "D$\$$הt&D$$ UWVSleD$\1I \$ $LHK -IK =JK 5I T$LK L$DDL$Dt&\$4$}'肓8tT$\e3fuJl[^_]ÍuT$5I L$1D$;T$2v\$4$ty+8t맍t&+t&'WVSD$$|$ @u [^_Ít&wvt$$yӒ8t1G[^_ft&賒8uD$D$$xډGD뼐&SI I $yʍ9x|  I $踔Hx| 1҅$I I $莔x| 1҅I t?I $h1҅tZI t&D$I $P諑8t1҉I [Ðx| $I I 1҉I [Ðt&c8&t&I C8DD$I $JxދI 8D$D$$Bx֣I x| f I ː8D$(I $xދ I 蛐8rD$D$$ʏx֣dI x| IfI S8D$D$$肏x֣$J  S$I I u} I u [ÍI fD$I $y 迏8tI  f諏8u$J D$$D$ݎxI [fI fD$I $y W8tI  fC8uI D$$D$uxI f I fD$(I $8y 8t I  fێ8udI D$$D$ x$I v'S$I uI uLI u{[Ít&@J fD$HJ $S8t1DJ I tJ D$J $H8t1J I tK D$K $8t1K [f@J Í8lD$D$$x֣J C&J {8\D$D$$誌x֣J 3&K 38LD$D$$bx֣DK # VS1ۃDJ t$I uDJ 5J uSK u)u [^Í&$I t[^t&I K 뾍& I unJ f5@J fD$HJ 4$xy /8t5@J f8CJ D$4$D$Ix!5J fD$J 4$y ϋ8t5J f軋8TJ D$4$D$x25K fD$K 4$y o8t5K f[8DK D$4$D$艊x$I Ív'T$tDI áI fHK Ð&IK Ð&JK Ð&I x$&fI Ív'LK D$ÍvD$LK $I ufsvÍv'HK PK IK QK JK RK PK ÍD$HK P@IK JK $I uÐt&t&' {SK |TK t|UK SK  ÍD$ PT$PT$$|Ív'VST\$t$`eD$L1$/t 8I 5I  I @J I J I K $%v9x|  I $d4x| 1҅$I tI $>x| 1҅I t?I $1҅tR5I t&D$I 4$@[8t1"fx| $I I 1ҡI I DJ J K HK IK JK $ZLK KK $I uD$Le3T[^Ív5I  談8uԉ\$4$|uHK 5I D$"IK D$!JK D$+t&\$4$yS8twD$D$$0#8&'t&5I 8TD$I 4$ xދ5I ӆ8$D$D$4$x֣I x| f5 I 苆8D$(I 4$xދ5 I [8D$D$4$芅x֣dI x| ]f5I 8D$D$4$Bx֣$J U WV`K S\$$v$ $ĆxL$4D$`= PM‰ӋT$81M]xi?B?BFEĜ[^_]Ív$?$PxÐ&VS\$$t&$D$ $(tPH$lPރSP SPS PSSP s ҉S~ )ʉS PҍJEC[^fS\$$$TD$ $tPlPSP SPS PSCC SPҍJEC[ÍvVSDt$P\$-lD$(FD$$FD$ F D$FD$FD$FD$4 $$~xN t t$8)t$4څO9t)ȃD[^ S8\$ D$D$\$t&+8uF$Y|tD$ D$$+K D$D$ D$D$8[Í&䍶VS4t$(\$ 軂8uVQt$$U}tD$ +K D$D$$D$ +K D$D$ 4[^Ít&K K D$ T$$뫍t&'VMbS4\$@L$D)‰ȉT$i)it$ )‰T$i\$\$)iL$t&$,t$\$$hzx܃4[^Í&'VS4D$t$ D$\$D$D$ $,dt$\$$zx܃4[^ÍVMbS4\$@L$D)‰ȉT$i)it$ )‰T$i\$\$)iL$t&$,t$\$$hyx܃4[^Í&'VS4D$t$ D$\$D$D$ $,dt$\$$yx܃4[^ÍVMbS4\$@L$D)‰ȉT$i)it$ )‰T$i\$\$)iL$t&$,t$\$$hxx܃4[^Í&'VS4D$t$ D$\$D$D$ $,dt$\$$xx܃4[^ÍS8\$+8uN$^xtD$\$(D$K ~8u.\$$K yt8[Ít&K \$(K K 8[ VSK t [^Ð5K uM${ãK tvK %$5K t${t1K t$$|u~"tD$$uD$($ uD$$ t'WVS|$ <$n|f$<$dxxK K 9r"ۉK \$$zt9ޣK s߉|$$3z[^_D$($ Xt&Hvt8ux$Rvtcsvvt$|ut@Ð+x$vu*s|t$tƍD$\$p|$xD$t$$2yx%D$ %=t.= t_=tH=`tI؋t$t\$p|$x|Í&| Í@0x`Đt&֐ ΐ4$ ~t뜐t&VS$D$ D$$t$yxxeD$0%=tM= tV=t=` t 1=@Í7 | @b2ZĄ[^ÐՐ1Ѝt&4$ }t | @b2B$D$yD$륍&S\$ $"DD$D$$sxH D$ [t&S\$ $"D$D$A$sxH D$ [t&S\$ $"D$D$$\sxH D$ [4t&S\$ $"TD$D$B$ sxH D$ [t&S\$ $"D$D$A$rxH D$ [t&S\$ D$D$$rywy8tڃ[Ã[ S\$ D$D$A$0ry'y8tڃ[Ã[? VSt$\$4@ $ | \$0$D$PuxԋD$m/F t+~` tii" tv1t[^Á t$BMS tI t1ǁx$ tEh$ t1링/4 tN/@ t/: z1sDM b{Q0 Q1J/ 9NTFS& (1!}  1+ S 1D$6$h'VSt$\$#ptDt?uBfk\$t$$sxˋD$ %=@t[^Ðt1[^D$5$gWVSp$\$,t&cp\$|$$sxD$ %=ua$d}mdt&9Lۉ4$\$6mtU\$t$<$ky$'ލp1[^_Ðt&p[^_D$$fD$($ fD$$ sfvD$$D$D$ $ pÍ'S\$ $A$jx[ÍvVSt$t$#ntDt?uPfkt$\$$rxˋD$ %=t=t t&t[^f$Hjt[^D$$efVSt$ \$$ $T\$4$Xnx[^Í&'VSt$ \$$ $7\$4$ox[^Í&'VSt$ \$$ $)\$4$(lx[^Í&'UWVS< e$, 1$P $T $QD$$ $D$$ D$$UƉD$ l$,D$9|$|9t$vt$|$D$l$D$D$$ |tt5D$D$l$$ 9i)׃|wD$$ D$$ $, e3uW< [^_]Ãv=zlD$&$xcD$D$dcOlD$D$McHg&S\$ $D$$kx[Ít&'S\$ $*$ex[ÍvUWV1S$HPD$D$,$dyAtkNjuD$D$,$PdyMttt뜍t&$܂D$D$b $PMPČ[^_]$t$蝂D$D$b $sP $ t$\$$@gx܋T$,uD$Lt$| D$Hu;D$| $DtD$t$$ixNf$&LD$t$$Xc|uUkOČ1[^_]Í$ D$D$$kx뽍$D$ D$D$$kx$DD$t$$hxVD$"$`&$b K K É'T$19K vK UWVS,t$@v$#4$lt5K tT K <,99At&9vj8Pu),[^_]Í&$e@@@ K K ,[^_]Ít&6,T$l$ $eT$t9ʼn9v9wK K ,[^_]É1JD$($ ^D$$ ^'K T$ $it Í1t&UWVSK T$0t$4<4$!ft&Xl$\$4$it<$iiu1ۃ[^_]É'SK \$ $jK [Ð,ɉ$É$ ։$$$($|$,$Of|$l$$[`FtjffD$|$$(`؋$ $$$$(,ÍvD$T$$b賗u$|$ D$t$cfWVS=|| tD | 11x!@u$Ii | =||  9r̃[^_Ðt&SD$ @| @t [Í$h| yhet uD$$ X\[ߖ $|| @b| t(1ҍt& u$t 蚀á? D$#D$$L D$ Aa? $^F | $p^| || Ð&VS||  | t#xw1& 2xW9u4vD$ $patB9މ5|| | v[ؐt& 9w[^ÉÃ[^1t&D$| @Í'D$ | @Ð&SD$ @| @t[Ë$f| yPct uD$$ @Z[ǔ&SD$ @| @u$kf| [Ív'$zT$ D$D$`t $SH S(| D$0@$beyFybB"vD$ $oY&$p $#ex&D$D$ D$D$D$$]y;aB"vD$8$Xt&$ svi$`y%aB"vD$$X([Ív$ 'D$| @@ÍWVS\$(D$ t$$tJ<@f;a8 tF$&*| \$t$8$2Zx9r&[^_Ív1[^_Í&[^_/W WVS\$(D$ t$$tR<@f`8 tN$D| \$t$8$_x9r.Dƒ[^_Ð1[^_Í&[^_V& | T$(D$ T$T$$@T$$3Y1҅IЃÍT$(D$ T$T$$@T$| $^1҅IЃÍWVSt$$|$ 4$Z^tP<t&_8 tF$D| \$t$8$^x9r!E9u[^_Ðt&UWVS C\$&$%<$_x|| H =| t0YW 1эR r09u4vD$<$[$[9 | ʉ؉5|| s 9wD$aAD$0$uD$D$`t $C|| =| t&W 1fэR rx|9u4vD$<$5[tl[9ލ | ʉ؉5|| v 9wD$aAD$4B [^_Ðt&1f 1뽐t&{t&'D$| @@ÍWVSD$ <@| 8$D$D$$L\x؉Ɓt%$ t$D$$\xܡ| L8[^_ÍvWVSD$ <@| 8$D$D$$[x؉Ɓu%$ Lt$D$$[xܡ| d8[^_ÍvS$ Y@$ eYC[Ít&'S\$ C$U\$ [UU1WVSt$0\$4~Ft%19PuMfՃ9ZtF9u<9t_T$8L$8҃ fPF[^_]ÉōvT$8D$8f E҃ fE[^_]Í, L$$[X.F눍t&UWVS|$0\$4wt#W19Jut&̓9Yt9u[^_]É1v\$8L$8Ӄ f#]ff]uǃ9ƉwvFt& 9Ƌ\L\w9vvD$$WGwЍv'D$@Ð&T$D$BT$  PЉ ȉ ȃ ЋT$ÐVS\$ t$$vSCy&Yu.Nu%vtθ[^Ív[^D$+$Pt&S(D$8T$0\$4T$ƒЃ fD$#t^9YutuQ褊fuVٺD$~T$([Љ ȉ ȃ Ð(1[Ð([Í([D$+$O&'VS$\$4$Xt$\$$Rt#\$D$$Q[^軉fuЉ$X 빐WV5| S|$t(| 1;;u;< Qtу9u[^_ÍvtD$ƒt.<tNB<~ܡL AfQ L A[^_fAfA L L A[^_A1뒍'D$ D$$D$PÍ'SD$ k| ؋PwD$ $T| @[Ð&VSL =L t$ t73R$D$Py V8tit&iL t$ [^1vSL =L tV8ttit&iL [Í$| @gS| tm1ҍt&DuL |  | @ L  L L Ѓ| á? D$#D$$ D$ Q? $N7v'| $O| | Ð&kD$| @Í&UWVS $ $$D$$,T$$4D$$(T$ D$,e$1DŽ$D$,$0$0| $85| t1| ZB1fƒHp9u,|5kD$| $OQ9=| | s')Љv@9w$ckD$D$ $99$D$ L D$$&M$0$ k\$8$TD$$Rt$\$$Lt$D$ $8 $CS|$| k $$k\ $L kD $kfD $k\ $$kk\\ $$kk\ f\ $$kk\\ $_$0\7$$e3 [^_]Í$0DŽ$qfDŽ$_1ۍ9Bt&Ki\$8$RD$$PD$$PD$$PD$$PD$$| k|tk$k|t%t&$ L Q| |ot? D$,IfD$$RL $P+L9t | sD$D$ $!65L cc5L v| 4$D$dJyKP&ttD$<$?G&3KLl$D$$tD$$Ju$8u$<=| R($@u$D5| R0$Hu$L| R$0<M$0~:u$HD$,$Gt!xD$4$Gxwu~$8u $TR$@u $=R$Hu $&R$Z?D$,T$D$D$$D$M$HzD$$Gb$G1뺋$D$$D$$Ox$0=L <$#ND$(zI9D$(D$$<$D$GtJ$GGe/T$ D$D$$F $PD$D$T<$ID$$<$D$bG<$貴<$$T$D$OT$$$$$$%$$$Ƅ$$D$ K$D$ $G$T$D$<$I$8D$@D$HDu{PL8&fkD$| fkD$| @ÐkD$| @kD$| @ÐT$19| rk| BÐ&kD$| @Ðt&kD$| @Ðt&VS#0\$$#c$L$D$J\$1ۉt$$Dt$D$ $0k$| J;JtBJBB fB<0Ĕ[^ÐVS/\$$b$)L$D$J\$1ۉt$$SDt$D$ $+0L ; L t L /Ĕ[^Ít& L 9L Í&'WVS$\$.$a$qK$D$aI\$|$$C|$D$ $u/| k$TsD$$[@vv.wx؉t$$Gy+$z| ؃xtӉt$$_Gx.Đ[^_ÍVS-\$$`$yJ$D$iH\$t$$Bt$D$ $}.| k$TsD$$c?vv1wwD$ $Fy#$| ؃xu͍-Ĕ[^Ív'VS,\$$_$I$D$yG\$t$$At$D$ $-| k$TsD$$s>vv1wwD$$Ey#$菭| ؃xu͍,Ĕ[^Ív'VS+\$$^$H$D$F\$t$$@t$D$ $,| k$TsD$$=vv1wvD$$Dy#$蟬| ؃xu͍+Ĕ[^Ív'VS+\$$^$G$D$E\$t$$?t$D$ $+| k$TsD$$t$D$ $*| k$TsD$$;vv1w1tD$$By#$迪| ؃xu͍)Ĕ[^Ív'VS#)\$$#\$E$D$C\$t$$=t$D$ $)| k$؃xtS)Ĕ[^fL @f@ L P.&D$$Ay$| ؃xu͍'WVS$\$'(D$ L D$$=$[$D$D$B$D$B$D$B$D$uB$D$eB\$kt$$U5L | 4$D$;,? D$D$$v D$ ,? D$#D$$p D$ +? D$7D$$ D$ +? D$D$$ D$ +? D$&D$$ D$ +? $ D$0{ W&$ =? eZ|$$1? $ D$*? $'{ g? D$D$$ D$ *? $'0K.-? D$-D$$d D$ *&$B`t&tǃ$e3$,$0$4$8<$GT`f={ u5? LYt$$0? $&끐$U`o&$X_W&={ u"? $ D$)? $u&v={ u"? $ D$(? $=&v={ ΡD$<$YD$ D$D$ ? $.>虡D$<$VYD$ D$D$ ? $.dD$<$YD$< D$D$ ? $`.F&={ ? D$D$$ D$ F(? $ %t&={ $ &? $ D$['? $$? HD$ ? D$8 D$$-? D$(D$$l D$ '? $^$D$ D$ $ [df| t$$gx܃[^Í t&'{t&'{t&';t&'D$@Ðt&D$`Í&D$T$xM @ BÐt&D$@ ÐS\$ C C%C %C0CD$(D$$C$fCC[Í'S\$ C CC%C %C0CD$$$~fc CC[ SD$T$ X xM X J ىH Z ˋJX H0HJHJHJHRP[Í'VSTD$`\$eT$L1ҍ4@$=Ld| \$0$Xex܉$|T$Le3uT[^$t&VSTD$`\$eT$L1ҍ4@$=c| \$0$dx܉$T$Le3uT[^t&VSTD$`t$eT$L1ҍ@$=lc| t$$xdx܋D$d4$D$t| $ru*$>c| t$$Hdx܋D$Le3uT[^fv'VSTD$`t$eT$L1ҍ@$=b| t$$cx܋D$d4$D$| $Tqu*$>\b| t$$cx܋D$Le3uT[^f:v'S\$ $vv$[Ív T$vNfv~ bf f-rOEV,t.vl ` t" %t%Kv Ít&,*wӁučt&fntv=t뜍t& ft %P{v2mЃK^ `G %0% %& =t&g5@B&'T$vQ@B%& t}?` tm tc uQÍ&,tF` t3 t# tX/vvÍttہtс uÐt&ntvVttuÍv% tKu _Ðt&2UKJ08Íg5' =- Ðf<Ív'VSD$ t$$@v$=]| t$$^x܃[^Í&'VSD$ t$$@| $mlu+&$>t]| t$$^x܃[^ÍVSTD$`\$eT$L1ҍ4@$=]| \$0$(^x܋D$T$Le3uT[^t&VSTD$`t$eT$L1ҍ@$=\| t$$]xܡ| d$$_ku%$>l\| t$$]x܋D$Le3uT[^fJv'WVSP|$`t$eD$L1$=[| t$$]x=xM G D$| $ju'v$>[| t$$\x܋D$Le3uP[^_v'VSTD$`\$eT$L1ҍ4@$=<[| \$0$H\x1D$T$Le3uT[^fWVSP|$`t$eD$L1$=Z| t$$[xD$=xM Wс ЉD$GD$D$0D$GD$'GD$&GD$*GD$)| $)iu'v$>4Z| t$$`[x܋D$Le3uP[^_vVSTD$`t$eT$L1ҍ@$=Y| t$$Zxܡ| D$D$'D$&$%D$D$%D$D$0D$ZD$*D$)| $4hu*$>'t49tG t9w1,[^_]Í&4$荈ڐ9v8ƉD$먉<$蕆<${tt 4랐t&4딍v1;t$tFu)%19sn,$DYtP',t$(֋L| \$$9r;@| r_\| 9r; | ru s\$$t$(,Ít& wL$$ L$xVɸtɉŐt&¸t0t\$$t$(,Ít&a¸ttԉL$$L$xɸYR 9'UWVSÃ< L$ l$PD$$T$,o  H| u0| DX| D$$-,|  D`| $ D$ <| D$$ TT$$$s D$(H@| ;L| r;0| rw $ D$  H| u0| DX| D$$l,|  D`| $ D$I| -8| F9,| -T$ B FBFBFM F1% ҉FF8| t;M 9t=yP!;Pu@ $$}L$<$L$L$$XF8| P8| T$(P \,$8|  BB8|  BtD$ 8hG58| l| F9,| `| 9 $ D$  H| u0| DX| D$$,|  D`| $ D$58| T$$D$(VT$,FF8| FT$$d  H| u0| DX| D$$",|  D`| $ D$$cz`| 9$] ? D$'D$$ D$ ? $+%@4D$$1$۾${D$(| 8| `|  @ ,| H| u0| DX| D$$,|  D`| $ D$58| F9,| `| 9 $ D$  H| u0| DX| D$$~,|  D`| $ D$[58|  , F 58| P $ D$  H| u0| DX| D$$,|  D`| $ D$58| s UWVS˃LqLD$L$<= T$T$8C01;-`| r;-| rr1=0| ws`XGC 9T$4=@| s$v 9w)ލFD@| T$L$(D$,$M$ ut=@| ;=L| r;=X| f`U1 hD$,C0D$(hD$0 S$L$8C0D$(h@| ʁʼnT$,)ʁhT$0S$C0D$(hD$0 @| T$<ŁhT$,D$<-8| D$(hD$0 hD$,C0 -8| D$(h|$, hD$0C0a' ? t{ ? 5 Q Q Q &M M M M M M \ M M M M u M M M M  M M M M  N N N  N  N N N N   N $N (N ,N  0N 4N 8N uRtơ? D$,D$$ D$ I褱t&R"\Z<t<u!B@R&,Z<t<u-!B؞R*Z<t<u-!B؞R,Z<t<u-!B؞gnT[R-aZ[Љ8u<t <tSR+?Љp!!BCZ[Љ8u<t <tSR(Љ)p!!BcZ[Љ8u<t <tSR)Љ!p~!!BKUZ[Љ8u<u9X_SR$dZ[Љ8u<u9(/SR%4Z[Љ8u<u9SR'789"#$%&'()*+,-789x }1ك}Ãx1øÛ<$f$l$<$f$ËD$0(ËD$ ÐVS4D$l\$DD$$D$hD$ D$dD$D$`D$D$\D$D$XD$D$TD$ D$PD$D$LD$D$@$ۉtt$$4[^Ð$$eԐ r D${ sr  &D$tD$鍾t&ÍT$Bt 9t D$hÍ8| b b u-%D$$j  NЃ$'8| u*%$,x$Ít&1$ƹ8| u %$% $耹8| u(%D$b $Dt$Z$8&L$<\$,e$,1$@$D$H\$$D$(蚧D$$D$$p F$ʺ$輺$论$蠺8| l$|$t$D$ D$\$$D$(tI$Y薧؋$,e3u#$<$@$D$HL,g$t&'S1Ƀ(8| D$P tJ@ ? %? >D$D$$P $n$`8| uV\$D$$赻D$t0$uXn([Í&1q$X$$$f? 8| @ t%@? r s $荸8| u?$D$  D$r D$s -s $V1$0$$WVS{ to { { <9s7&3D$c 4$stЉ4$9ߍvw֋ { $({ {  { [^_Ít&'VS8| p7OC%X={ $D$x{ ;{  { t+${ QF [^ÍvtL{  { T$$p'{  { 먍v$ t{ `1L{ $@&{  { _D$D$$ ÉƁCh$u UC$UC 4$薴$$&'8| \$t$|$XuM$荷s\$4$G`u$4$\$t$|$$膳D$D$$ ƉǁFh$| TF$TF <$觳&VS$߶D$c É$蝼tЉ$t&+u; {  { 9r v9v;uR {  [^D$D$$ @ÉƁCh$ SC+$SC 4$ز&$Љ$Ív$$ySÐ8| >t $%uPH uuʉuuЁÍvVS$8| pƒu&u9>t\ui%$[^fT$4$T$t1ߍ&4$tD$4$ gu%t$f$F[^ÐFN uҩuˉuuG&ST$1>t[Ðt& uJZ uցuΉu1[ÍT$JB %Ðt&T$D$с%hhHP Ðt&8| T$ \$t$D>t$֯Á u݋Ks úuʼnuu\$t$Ðt&S8| D$ T>t $\t& uJZ uuɉuuȁ[É'8| Ru% h$8| Ru h$膮X8| Ru% h$A8| Ru h$8| Ru$$ĭt&8| Ru$$脭t&X8| Ru$$Dt&8| Ru$d$t&8| Ru$$Ĭt&8| Ru$$脬t&VS58| ^>uFCVu@ً% hhA ؉Q[^$$ v' 8| QuЉ$%M$ūt&VS8| RuQӁÉ$L$GT8| сhh%HP [^$F8| Ru t$[L$t&'S8| RuPӁø t6$L8| hhJZ [$x&,\$8| t$ |$$l$(s uz%{ʼnu~[ueF$%D$]\$l$D$ \$t$ |$$l$(,$ĩ$踩$謩Sw8| Ru"Ӂ$讪 [$VS'8| Ru"Ӂ$^ [$S8| Ru#Ӂ$f [$赨t&S8| Ru#Ӂ$辩f [$et&S78| Ru"Ӂ$n [$S8| Ru"Ӂ$ [$ƧS8| Ru"Ӂ$Ψ [$vSG8| Ru"Ӂ$ [$&S( 8| Qu!$ ([$צ&S 8| Qu!$/ [$臦&SW8| RuӁ [$='S8| RuGӁU8| ځhh%PX  [$\$8| t$|$suTyS~uEЉ|$t$$误 \$t$|$$>$2ft$58| \$|$^Vuzs<\$<$t$8| \$hh|$%p t$P $~$rf,\$8| t$ |$$l$(s uz%{ʼnu~[ueF$%D$]\$,$DD$ \$t$ |$$l$(,$ģ$踣$謣\$t$$I$8| >t$cv uދJr u΁uƉuu%\$ ht$hB  JÍ&t$̦ Ív{ Ív'S{ \$$9{ s\$${ x{ T$ \$$T$菦{ [Ít& D$T$);{ r É D$9{ w {  (v8|  u'%~P@ %$t&$ѥuÐD$$ { u1D$ D$D$$ { { { P9{ sD$${ ({ { { B9{ { sD$${ { T$ { {  -$tD$$  $ $ 臠&S{ { H9w&HX9w;\$ @u;{ u { [ø$ i$ '{ P9{ sD$${ { { { B9{ { sD$${ 读{ T$ 8|  {  P P@8| $%D$蹮8| P@ 8|  T$ Ít&'S{ { H9wHX9w{ 9Pu[կ$L G"$ ֞S{  { B9w BZ9w;\$ u { 9Ju[øq$ $ rfD$ -{ ;{ r { $ $ 4t&S { \$ j8|  9,| .{ { P9{ { { B9{ { T$$8| { { @P  ,P @P{ P PP8|  P$>$eu-{ [Ðt&D$$ [ؐD$${ { 4fD$${ { f\$$ ( h[Ít&D$ D$D$$$ D$ D$D$$ { { ң{ t2\$$ w h[Ð&S{ { H9w!HX9w{ 9PuӃ [ø$ 3$ ›f訚 F %t 8| $A; ڍv'$!;S{  { B9w BZ9w;\$ u { 9Ju[ø$ sN$ fVS<| t$ %$迡v8| P9,| v{`| 9 $ D$  H| tfD$$趩,|  D`| $ D$蓩8| PL$$hpXH8| @[^Ðt&0| DX| $\$$P CD$$:$~9$] fD$ $q$U9t&t&'[t&'t&'8| L$ D u&%~P@ %É $8&,8| |$(|$0t$$\$ tƒu/uB>teur%\$ t$$|$(,ÐT$4$4T$t1֍&4$tD$4$tNu%t.<$n\$ F|$(t$$,Í&FN u©uuu. 黮t&';t&'t&'8| \$T$ t$|$@u \$t$|$Ít&>t$肗fÁ u݋K{ úuʼnuuсhhKS s S8| Xu [Ít&>t$ږfځ%uދBJ uΩuljuuT$$ȉ$T$T$ T$舚xvVS@| L| L$ 9r50| 9 Z G 9 9s$Κ $ 0 $ D$8  H| u0| DX| D$$,|  D`| $ D$Ӥ@| +G | xZ93 BBhB hBʁ@| ÁhhSK [^$ $ +t&'S tDu$迪t;$[Ít$| 1[Ív[$ 1[Ð&S tDu$诫t;$[Ít$| wR1[Ív[$ T/1[Ð&S t tu$ʘt&$[Ð$4 [$` [Ð&V1S $u't%t >tS$ 1p[^É$萪tD$$ Iu$ Z5Ív%uCK uuvj4lD$ 9 r$ q Ív' Ív'D$%%Í'D$%Ív T$L$%9} xD q8| u&%D$$2 $ $ʑD$ { ÍvD$H @Í&'SD$ 8| T$Y8| A %  B[ SD$ 8| L$ZB 8| %B   A[Ð&D$$L$ t$8| p 58| XQ$  t$É'SD$ L$8| X@ @ 8| @   Q[ÐD$$L$ t$8| p @ 58| XQ$  t$fD$t$L$ $8| p@ 0p58| XQ$  t$ÍvSD$ L$8| X@ @ @ 8| @   Q[Ív'D$$L$ t$8| p @ @ 58| XQ$  t$Ít&'D$t$L$ $8| p@  pp58| XQ$  t$Í D$t$L$$|$8| px@ 0p58| xXQ$  t$|$ Ðt&S8| D$\$J BD$B| )% hBB8| B^,ќH C1[ UWVSÃ8| )9,| vs`| 9 $ D$  H| tOD$$远,|  D`| $ D$蜜  t![^_]Ð0| DX| 렍&8| <90tэt&019u18| 9t 9u1[^_]$]  'UWVSLWHXT$Wiw D$(BD$$ 1Eow tut6 _ 8| Z_+_hZ))hhjZZJO+O hJOhJ | )hJJ܉ 8| B[,D$fD$L[^_]fD$$pD$8D$$?D$(GL[^_]Ít&D$$D$1;t$T$(l$,l$$|$$|$(T$ tU\$9t$T$ )D$T$$ՃtЋ|$$l$,OW`t&\$9t$vc$>)T$T$ $T$Ճt봍t&D$$;v,$L$>L$D$ivl$,|$$OW<\$,t$0|$4|$Ll$8$-?@| ;L| 8rr -0| 9ro   h1 @| CD$$>D$ƋD$D$?<t+\$,t$0|$4l$8<Ðt& 9s눍&)؉D$D$D$t$$#<uD$H4$D$~>uCt%L1TPuD$$4>T$@ Yt& $ D$8  H| u0| DX| D$$,|  D`| $ D$Η5| vUWVS\D$tl$pD$4$D$0D$xD$$D$|D$($D$, { v\$D$@> $w { &D$,9D$4D$(D$DD$8D$(Ё%D$Ǎ5 bVS$ 8| %| 8| 8| D$$ށt$0t38| X PP8|  P$[^Ðt&D$tt ut&4$脻$[^Ív'W8| VSt$ (t/,t-9Љ| Xt H9u| 8| [^_f|9tL9Љu[8| ^_| VS8| T  tW; | tV9Ѝpt&H9u| T )% hBB8| B,蝋58| [^Ð9tL9Љu8| [^騋&UWVSӃ,9Ћ-@| );-L| < =8| 4 ʉD$߉t$<40Ɓ9Ӊpw|$ҍDӍtɍ\$5@| F \t1f>9ȉ;u؍8| ,[^_]Í&0| 96D97%Q؉L$L$8|  ,[^_]Ðt& $ D$蘊  H| u0| DX| D$$V,|  D`| $ D$38| =| Pp8| X,[^_]Ít&VSÃ$%D$D$$-u~L$uNT$9rT$|$9v}8| PX8| p $ [^Í8| PX8| p$[^Ð8| PX8| p$1[^иt8| PX8| pz뜍vщ؉댸녍S8| X8| t[Á$[Í',t$$t$4D$\$ \$0|$(|$8$t$+uD$u|$tL$9sB8| Pp8| xH C1\$ t$$|$(,ÍvL$ tH Cˍ  s뺐t&UWVSL 8| %|  8| T$0H)ʉT$4PH  L$HD$$T$H\$(L$H8| %D$,L$ %$ 蜙 { |f\$D$@> $dgD$ { t\f\$ t$8\$4$*+\$8|$<u顨| tӵtnL[^_]ÅuD$T$0vu@D$9D$$s4D$D$4D$(D$Ё%D$,t막]fD$ $pL[^lj_]U1WVS,D$@%x(t@| L| 9r=0| 9  G 99s$Κ ȴ$ lbt& $ D$p  H| u0| DX| D$$.,|  D`| $ D$ @| +G أ| u,93D$D$ $變D$%PT$%9‰D$%tuD$D$$MÁD$%| hC11҅ tU9v&4$ )9wT$D$9T$T$QD$,[^_]Ðt&9wĉЁ,|9l$w*ǁ|9|$ǃ%T$tu1҃‰1҅‰ \tT$Kq$ J$ _&'VS@| ;L| \$ t$$;0| 8| ;,| `| 9U $ D$蘂  H| u0| DX| D$$V,|  D`| $ D$38| t pD$(JB| )% hBB8| BC,gH C[^Ít& $ D$ȁ  H| u0| DX| D$$膁,|  D`| $ D$c@| +0| | $] ? D$D$ *v' D$ f D$ fD$ vL$ vD$ D$t&'@| t$t$$\$\$ |$=p| G F 5 ;=p|   8|  G   9 @| 8| s-  8| %C\$t$|$Ít&\$ t$\$|$D$(D$$F $ D$$ \&D$$t$\$\$ 0@$%D$t$$t$\$ \$D$0D$,D$(@| \$\$$t$t$ |$=p| G F  ;=p|  F  9 @| G 8|  8| s*  8| %F\$t$|$Ðt$ \$t$|$D$(D$$F $ D$褭$ H[&D$D$D$D$ D$'<<| \$,\$DT$H|$4%t$0 t$@l$8(,t?8| HX 8| P&H F\$,t$0|$4l$8<Ðt&߁o|$ }989}u}| tu` F %< T F J9~8| HX 8| P]H F 2vL$( 8| y=8| YÐt&tYH FvL$$||$4\$Dl$8t$@\$,t$0D$PD$LD$H<  ^t&\$D|$4t$@\$,t$0l$8D$PD$LD$H<8| T$HHHP@ 8| P<| D$D$D$ %D$n&'VS4D$Dt$HÉD$D$ $1҄uD$ t wrtr1ҍv8| PPPPX8| X<| D$D$ D$%D$D$@$4[^Í&u  닍vw1p&T$D$D$B%D$ D$Ut&<| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$_ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$_ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$_ <| D$D$D$ %D$ <| D$D$D$ %D$ <| D$D$D$ %D$ D$D$D$D$ <| %D$_ \D$dl$X|$T\$Lh8@t$P%$T$(5<$D$,D$w/S1;$+FCt$\$|$Ít&S\$$C $ͨT$ )‰S[ T$fztÍt&'D$1fxÍ&'D$Ð&D$ Ð&D$Ðt&D$PD D$@Ð&D$Ð&\$\$ t$t$$$Ft$\$Ãt$t$ \$\$$F$貧t+CF\$t$Ív'S\$ C$}C[Ðt&S\$$CC$YT$ )‰S[Ít&'D$@Ð&D$T$D@à D$T$@@@HP | t1 Ít&'S  D$ $   D$ $   D$ $  { D$ ${ m  D$ $ O  D$ $ 1  D$ $   D$. $   D$B $   D$\ $   D$p $   D$ $ }  D$ $ _  D$ $ A  D$ $ #$  D$ $ ]( N D$ $N ,  D$ $ 0  D$ $ 4  D$ $ 8  D$) $ g< z D$; $z I@ J D$L $J +D R D$` $R  H " D$v $" L   D$ $  P  D$ $ T  D$ $ X  D$ $ w\  D$ $ Y`  D$ $ ;d  D$ $ h  D$ $ l 2 D$" $2 p T D$6 $T t v D$J $v x  D$^ $ |  D$r $ i  D$ $ K  D$ $ -  D$ $ | ) z D$ $z D$ $(  ( D$ $   [fD$ $ (  D$ $ ,  dD$$ $ 0  FD$6 $ 4  (D$F $ 8   D$U $ <  D$c $ @  D$t $ D  D$ $ H  D$ $  L   tD$ $ P  VD$ $ T  8D$ $ X  D$ $ \  D$ $! ` ! D$ $s  s 8| (u $$4Ct&8| (u$t h$B | $0[Í8| ;u6%;`| r| 9s)‰$Z$B$zBv',8| (,%D$D$$u|$v(hhhD$T$ $i,Ðt&D$$$ t&8| h| 9h h볍t&hhk랍&hhh농&hhhkt&D$hh% hJvT$D$Ѐ|$t%h hhhhh$ A,$DT$T$D$8| $t$ At&G ;L| ;@|  $ D$O  H| u0| DX| D$$O,|  D`| $ D$~O@| +G  | #@vD$,$Κ ~$ 0,$ t~$ ,&8| (u$t8| $$?$?t&$QC$1t$Ðt&$!C$91t$Ðt&1Í'VS$B8| RƉu9p| T$$4{ b։$a4$'W[^$>t&4{ Ív'8| =u$ $> w&S8| (uE$=u?8| $:$ t [Ív[$=$>&'8| \$t$(u)t)1D$8,$D$D$4D$9u߃[^_] Ë$ÐUS t fЋu[]ÐS[[P[@L?@?leaf_make: malloc failed. tree_insert: Duplicate entry %s. N %s: unable to allocate obstack chunk of %d bytes MIT/GNU Scheme running under %s Configuration won't hold initial data. The interpreter returned to top level! BINARY-FASLOADSCODE-EVALLOAD-BANDSTACK_CHECKUNKNOWNCOMPILED_RETURN_ADDRESSCOMPILED_PROCEDURECOMPILED_ENTRYCOMPILED_EXPRESSION()#F#T[UNSPECIFIC][RETURN_TO_INTERPRETER][REFLECT_TO_INTERFACE][ACCESS (%c[SET! (\\\"\t\n\f\%03o[DEFINE (%lf{weak} . [UNINTERNED_SYMBOL ([VARIABLE ( ...)[ENVIRONMENT 0x%lx] (from [EXTENDED_LAMBDA () 0x%lx[EXTENDED_PROCEDURE () 0x%lx][LAMBDA ([PRIMITIVE Unknown primitive %#08lx[PROCEDURE ([REFERENCE-TRAP tag extra[RETURN_CODE [0x%lx]COMPILED_CLOSURE[%s offset: %#lx entry: %#lx address: 0x%lx file: block: %ld[%s[%#02x %#lx]{%#lx} Return codeExpression ... (skipping)**** filename not known ****Not created by a procedureName Value Auxiliary Variables %4lx: Primitive: ...Arg %ld[COMBINATION (%ld args) 0x%lx]Not a debugging version. No flags to handle. X`@`H8ȩh@hXƮƮʹ`ʹʹʹ0Hʹʹʹʹʹʹ ʹʹнʹhʹʹ@ʹxʹʹʹؼʹʹʹ ʹʹʹʹʹʹʹʹʹpʹʹʹʹ` Microcode requested primitive GC outside primitive! Free has gone backwards! wbrb Bad version in FASL File: %s File has: version %u architecture %u. Expected: version between %u and %u architecture %u. Bad compiled-code version in FASL File: %s File has: compiled-code interface %u; architecture %u. Expected: compiled-code interface %u; architecture %u. Heap: %#lx-%#lx, Constant: %#lx-%#lx, Stack: %#lx-%#lx past the point of no return. Pointer out of range: %#lx band load load-band: Unknown error %#lxError %#lx (%s)Abort %d (%s)file name = "%s". 9B.9B.?f3þҿf3þ?)))t)t)))))+++x+x+++++44x4h4X4H43x34544444444444444444444444444444444444444444444 655555555d9X9?966X9X9X9X9::p:):):::::<<<p<`<P<;;< =<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<=========>>===>>>>scan = 0x%lx; to = 0x%lxUnknown linkage-section type.broken heart in scan: %#lxGC transport not allowed hereNo compiled-code support.bad type code: %#02lx %#lxunknown GC special type: %#02x tospace is open, should be closedNon-pointer cannot be a weak reference.abort_to_interpreter: Interpreter not set up. There is no trap handler for recovery! Primitive slipped the dynamic stack: %s yz8zPzzyq({@{P{Hyhyxyyqyyqyqyqyqyqyqyqyqyqyqyqyqy(yxvqqqqqs8sqqqqqqqtqqqrqqqqqqqqqqqruqu{uù+u/uuluuuuuuuuuсǁuuhuuuuuuuuuuuuuuuuuuuuuuuuuuuuuՃu\uuuuuuuuuuuuREu5%Uu~rrrrx}qryrrr0~rrrrrrrr0~eyyyyyyyyyyyyyyy҅y}y׉yyyyyySGlyyC* }yy}dyyyyyH8( Ran out of guaranteed space! hhhhhhhhhhhhphhhhhhhhhhhhhhhh!HGCgarbage collectorgarbage collector daemonUnable to allocate temporary heap for GC. Not enough memory for this configuration. Requested allocation is too large. Try again with a smaller argument to '--heap'. %s: The stack has overflowed and overwritten adjacent memory. This was probably caused by a runaway recursion. GC has been delayed too long! Free = %#lx; heap_alloc_limit = %#lx; heap_end = %#lx 5a 0`   0 ` Y0`default%s: can't find a readable %s for option --%s . %s bug-mit-scheme@gnu.orgall.comyesnobatch-modeconstantemacsfaslheaplibrarynocoreoption-summaryquietsilentcompileredwinutabutabmd----version--helpMITSCHEME_LIBRARY_PATHruntime.comedwin-mechanics.comMITSCHEME_BANDMITSCHEME_HEAP_SIZEMITSCHEME_STACK_SIZEMIT/GNU Scheme microcode 15.3 %s size: %d constant-spacelibrary path %s: :%sFASL file %s: %s emacs subprocessforce interactivedisable core dumpsuppress noise no unused arguments unused arguments: searched for file %s in these directories: Usage: mit-scheme --OPTION ARG ... --OPTION ARG ... This machine accepts the following command-line options. The options may appear in any order, but they must all appear before any options for the band. --library PATH Sets the library search path to PATH. This is a colon-separated list of directories that is searched to find various library files, such as bands. If this option is not given, the value of the environment variable MITSCHEME_LIBRARY_PATH is used; if that isn't defined, "/usr/local/lib/mit-scheme" is used. --band FILENAME Specifies the initial band to be loaded. Searches for FILENAME in the working directory and the library directories, returning the full pathname of the first readable file of that name. If this option isn't given, the filename is the value of the environment variable MITSCHEME_BAND, or if that isn't defined, "runtime.com"; in these cases the library directories are searched, but not the working directory. --fasl FILENAME Specifies that a cold load should be performed, using FILENAME as the initial file to be loaded. If this option isn't given, a normal load is performed instead. This option may not be used together with the "--band" option. --heap BLOCKS Specifies the size of the heap in 1024-word blocks. Overrides any default. --constant BLOCKS Specifies the size of constant space in 1024-word blocks. Overrides any default. --stack BLOCKS Specifies the size of the stack in 1024-word blocks. Overrides any default. --option-summary Causes Scheme to write option values to standard error. --help Causes Scheme to report the available command line options. --version Causes Scheme to report versions and copyrights, then exit. --batch-mode, --quiet, --silent Suppresses the startup report of versions and copyrights, and the valediction. --emacs Specifies that Scheme is running as a subprocess of GNU Emacs. This option is automatically supplied by GNU Emacs, and should not be given under other circumstances. --interactive If this option isn't specified, and Scheme's standard I/O is not a terminal, Scheme will detach itself from its controlling terminal. This will prevent it from getting signals sent to the process group of that terminal. If this option is specified, Scheme will not detach itself from the controlling terminal. --nocore Specifies that Scheme should not generate a core dump under any circumstances. Please report bugs to %s. Additional options may be supported by the band (and described below). /mit/scheme_v9.2/arch/i386_ubuntu1404/lib/mit-scheme-i386%s: option --%s requires an argument. %s: can't specify both options --%s and --%s. %s: can't read option file: --fasl %s %s: can't read file %s for option --%s. %s: can't read default file %s for option --%s. %s: illegal argument for option --%s: %s %s: illegal value for environment variable %s: %s Summary of configuration options: *** Scheme Microcode Back Trace: *** *** End of Back Trace *** . @ 5  D  T a {   a  ϸ ݸ    * 6 B L V e t      Ĺ ޹   prim_procedure_treebuildingaliasingFALSE?PRIMITIVE-TYPEPRIMITIVE-TYPE?&MAKE-OBJECTPRIMITIVE-OBJECT-SET-TYPESYSTEM-MEMORY-REFPRIMITIVE-OBJECT-REFPRIMITIVE-OBJECT-NEW-TYPEFILE-CLOSE-CHANNELCHANNEL-CLOSEGET-NEXT-INTERRUPT-CHARACTERTTY-NEXT-INTERRUPT-CHARREMOVE-FILEFILE-REMOVERENAME-FILEFILE-RENAMECOPY-FILEFILE-COPYMAKE-DIRECTORYDIRECTORY-MAKESCREEN-X-SIZETTY-X-SIZESCREEN-Y-SIZETTY-Y-SIZEFILE-SYMLINK?FILE-SOFT-LINK?X-GRAPHICS-SET-CLASS-HINTX-WINDOW-SET-CLASS-HINTCURRENT-FILE-TIMEENCODED-TIMEinitialize_primitives: Error %s %s. Error declaring unknown primitive %s. purifypurify daemon Insufficient constant space! (-R-((-i,-i,i,i,,+***`*((*)((((.)(q3`::;~;/33"/4<3644$5J5~5P66 7P7788L999non-objectsystem-interrupt-vectorsystem-error-vectorobarraymicrocode-types-vectormicrocode-returns-vectorinterrupt-mask-vectormicrocode-errors-vectorsystem-call-namessystem-call-errorsgc-daemontrap-handleredwin-auto-savestepper-statemicrocode-fixed-objects-slotsfiles-to-deletedummy-historybignum-onemicrocode-terminations-vectorcompiler-error-procedureprimitive-profiling-tablegeneric-trampoline-zero?generic-trampoline-positive?generic-trampoline-negative?generic-trampoline-add-1generic-trampoline-subtract-1generic-trampoline-equal?generic-trampoline-less?generic-trampoline-greater?generic-trampoline-addgeneric-trampoline-subtractgeneric-trampoline-multiplygeneric-trampoline-dividegeneric-trampoline-quotientgeneric-trampoline-remaindergeneric-trampoline-moduloarity-dispatcher-tagpc-sample/builtin-tablepc-sample/utility-tablepc-sample/primitive-tablepc-sample/code-block-tablepc-sample/interp-proc-bufferpc-sample/prob-comp-tablepc-sample/ufo-tablecompiled-code-bkpt-handlergc-wabbit-descwiptorcallback-handlerMoriturus te salutoBroken heart encounteredNon pointer relocationNonexistent return codeControl stack messed upNot enough space for stack!No error handlerNo interrupt handlerUnimplemented return codeInconsistency detectedEnd of input stream reachedBad primitive invokedTermination handler returnedEnd of computationUnknown type encounteredUnhandled signal receivedBacking out of non-primitivehaltdisk-restorebroken-heartnon-pointer-relocationbad-rootnon-existent-continuationbad-stackstack-overflowstack-allocation-failedno-error-handlerno-interrupt-handlerunimplemented-continuationbad-primitive-during-erroreofbad-primitivetermination-handlerend-of-computationinvalid-type-codecompiler-deathgc-out-of-spaceno-spacesignalsave-and-exitbad-back-outbad-error-codeunbound-variableunassigned-variableundefined-proceduresystem-callerror-with-argumentbad-frameundefined-primitive-operationexternal-returnexecute-manifest-vectorwrong-number-of-argumentswrong-type-argument-0wrong-type-argument-1wrong-type-argument-2bad-range-argument-0bad-range-argument-1bad-range-argument-2macro-bindingfasdump-object-too-largesyntax-errorfasl-file-too-bigfasl-file-bad-dataout-of-file-handlesbad-range-argument-3bad-range-argument-4bad-range-argument-5bad-range-argument-6bad-range-argument-7bad-range-argument-8bad-range-argument-9wrong-type-argument-3wrong-type-argument-4wrong-type-argument-5wrong-type-argument-6wrong-type-argument-7wrong-type-argument-8wrong-type-argument-9inapplicable-continuationcompiled-code-errorfloating-overflowunimplemented-primitiveillegal-reference-trapwrong-arity-primitivesfasdump-environmentfasload-bandfasload-compiled-mismatchstack-has-slippedcannot-recurseprocess-terminatedDONEDO-EXPRESSIONNO-TRAP-EVALNO-TRAP_APPLYAPPLY-INTERRUPTREENTERNO-TRAP-POP-RETURNRETURN-TO-CABORT-TO-Cfalsepaircharacterquotationuninterned-symbolflonumextended-procedurereturn-codemanifest-closurebignumentitydelaypromiseextended-lambdacommentnon-marked-vectorsequencefixnumcontrol-pointaccesshunk3-adefinitionassignmenttriplecombinationmanifest-nm-vectorcompiled-entrylexprephemeronthe-environmentvector-1bvector-16bconditionaldisjunctioncellweak-consquadlinkage-sectionratnumstack-environmentrecnumcompiled-code-blockrecordjoin-stackletsinternal-applyrestore-historyassignment-continuedefinition-continueaccess-continuesequence-continueconditional-decidedisjunction-decidecombination-applycombination-save-valueforce-snap-thunkreenter-compiled-codenormal-garbage-collect-donepop-from-compiled-coderestore-valuerestore-dont-copy-historypop-return-erroreval-errorstack-markercompiler-interrupt-restartrestore-interrupt-maskcompiler-link-caches-restarthardware-trapinternal-apply-valcompiler-error-restartRESTORE_CONT, expressionRESTORE_CONT, return codeSAVE_CONT, expressionSAVE_CONT, return codemicrocode-identification-vectormicrocode-terminations-procedurespc-sample/purified-code-block-block-bufferpc-sample/purified-code-block-offset-bufferpc-sample/heathen-code-block-block-bufferpc-sample/heathen-code-block-offset-bufferUnrecoverable error while loading a bandCannot restore control state from bandStack overflow: Maximum recursion depth exceededError during unknown primitiveMismatch between compiled code and compiled code supportOut of space after garbage collectionOut of memory: Available memory exceededHalt requested by external sourceUser requested termination after trapcompiler-reference-trap-restartcompiler-assignment-trap-restartcompiler-operator-lookup-trap-restartcompiler-lookup-apply-trap-restartcompiler-safe-reference-trap-restartcompiler-unassigned?-trap-restartvvvvvvvvvvvvvvvv ߑhP8vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvБvvvvvvvvvvvvvWW`@W؞؞  Z0ףEE9E E[[Auto-saving file "%s" %s. Unknown termination code %#x within critical section "%s"Final result --heap %lu --constant %lu Killed by %s. Try again with values at least as large as You are out of space at the end of a garbage collection! # words needed = %lu; # words available = %lu no transactiontransaction_abortcommit in progressabort in progresstransaction_committransaction_record_actionstandardIA-32INTEGER-ZERO?INTEGER-POSITIVE?INTEGER-NEGATIVE?INTEGER-ADD-1INTEGER-SUBTRACT-1INTEGER-EQUAL?INTEGER-LESS?INTEGER-GREATER?INTEGER-ADDINTEGER-SUBTRACTINTEGER-MULTIPLYnonemc68kvaxhppasparci386alphamipssvm1x86-64system-release-stringmicrocode-versionconsole-widthconsole-heightnewline-charflonum-mantissa-lengthflonum-epsilonos-name-stringos-variant-stringstack-type-stringmachine-type-stringcc-arch-string#[(microcode)arity-dispatcher-tag]            % Interrupts = %#08lx, Mask = %#08lx, Masked = %#08lx Will_Push vs. Pushed inconsistency. Unable to get interrupt handler.Unknown error code %#lx. Error code %#lx (%s). No error handlers Microcode Error: %s. **** Stack Trace **** Invalid fixed-objects vector )*+,-./"#$%&'(dstack_set_positionposition argument not foundno more stackstack slipped during unwindunknownunix-pipeunix-fifoterminalunix-pty-masterunix-stream-sockettcp-stream-sockettcp-server-socketunix-character-deviceunix-block-deviceos/2-consoleos/2-unnamed-pipeos/2-named-pipewin32-anonymous-pipewin32-named-pipe       * <  N d v     /proc/sys/vm/mmap_min_addr%lu/proc/%d/maps%lx-%lx unable to unmap heap: %lx bytes at %punable to mmap executable heap -- native code will probably failDzDCcifscoherentextext2hpfsiso9660minix1minix1-30minix2minix2-30fatncpnfsntfsprocsmbsysv2sysv4xenixxiafs Unable to allocate channel table. w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w 8x x x x x Gx x x x x x x x x x x x x Gx x x Gx x x x x Gx x x x x x x x Gx Bx bx bx bx bx xx bx bx bx bx bx bx bx bx bx bx bx bx xx bx bx xx bx bx bx bx xx bx bx bx bx bx bx bx xx  Unable to allocate process table. ;;; Renicing! New nice value = %d Unable to grow signal definitions table. Enter location to examine (0x prefix for hex): Problems reading keyboard input -- exiting. When typed, scheme will get the ^G character interrupt. The default action is to abort the running program, and to resume the top level read-eval-print loop. When typed, scheme will terminate. When typed, scheme will suspend execution. When typed, this character will be ignored. When typed, this character will have an unknown effect. When typed, various interrupt options are offered. Type %s followed by `?' for a list of options. Interrupt option (? for help): Enter the stack trace filename (default: terminal): Writing the stack trace to file "%s" -- Scheme is executing within critical section "%s". Resetting now is likely to kill Scheme. Choose one of the following actions:Problems reading keyboard input -- exitting. Do you really want to reset? [Y or N] The interrupt character is %s. The terminal stop character is %s. Problems reading keyboard input -- Exitting. ^C: Goto to top level read-eval-print (REP) loop. ^U: Up to previous (lower numbered) REP loop. ^X: Abort to current REP loop. D: Debugging: change interpreter flags. H: Print simple information on interrupts. Q: Quit instantly, killing Scheme. R: Hard reset, possibly killing Scheme in the process. Z: Quit instantly, suspending Scheme. Unable to allocate signal definitions table. USE_SCHEMATIK_STYLE_INTERRUPTSD = delay reset until the end of the critical sectionsystem software faulthardware faultfloating-point exceptioncontents^?Error opening "%s". Done. Action -> The quit character is %s. Ignored. Resuming Scheme. ^B: Enter a breakpoint loop. ^L: Clear the screen. E: Examine memory location. I: Ignore interrupt request. T: Stack trace. unknown signal %dSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGIOTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGIOSIGURGSIGVTALRMSIGPROFSIGSTOPSIGTSTPSIGCONTSIGCHLDSIGTTINSIGTTOUSIGXCPUSIGXFSZSIGPWRSIGWINCHN = attempt reset nowP = punt reset   P    P     `                                                           P 0         `   `                   P 0         `   `        Unable to allocate terminal table. /dev/ptmxunixGNU/Linuxacceptbindchdirchmodclock_gettimeconnectfcntl-getflfcntl-fullfsyncfcntl-setflfdatasyncfstatfstatfsfsync_rangeftruncategetcwdgethostnamegettimeofdaygmtimeioctl-tiocgpgrpioctl-tiocsigsendlistenlocaltimelseeklstatmallocmkdirmktimentp_adjtimentp_gettimeopendirpausereadreadlinkreallocrenamermdirselectsetitimersetpgidsetsockoptshutdownsigholdsigprocmasksigsuspendsleepsymlinksync_file_rangetcdraintcflushtcgetpgrptcsetpgrpterminal-get-stateterminal-set-statetimesunlinkutimevforkwriteaddress-family-not-supportedaddress-in-useaddress-not-availablearg-list-too-longbad-addressbad-file-descriptorbroken-pipeconnection-refusedconnection-resetdirectory-not-emptydomain-errorexec-format-errorfile-existsfile-too-largefilename-too-longfunction-not-implementedhost-is-unreachableimproper-linkinterrupted-function-callinvalid-argumentinvalid-seekio-erroris-a-directoryno-child-processesno-locks-availableno-space-left-on-deviceno-such-deviceno-such-device-or-addressno-such-file-or-directoryno-such-processnot-a-directorynot-enough-spaceoperation-not-permittedpermission-deniedread-only-file-systemresource-busyresource-deadlock-avoidedresult-too-largetoo-many-linkstoo-many-open-filesType %s followed by `H' to obtain information about interrupts. Scheme has terminated abnormally! Would you like a core dump? [Y or N] Do you really want a core dump? [Y or N] inappropriate-io-control-operationresource-temporarily-unavailable" '!#%  +*$) (&  abc oh'!$&q %  # "floating-point divide by 0 trapinvalid floating-point operationinvalid permissions for mapped objectobject-specific hardware errorsignal generated by timer expirationsignal generated by asynchronous I/O completionsignal generated by message queue arrival >> A %s has occurred within critical section "%s". >> The stack has overflowed overwriting adjacent memory. >> This was probably caused by a runaway recursion. >> The trap occurred while processing an earlier trap. >> [The earlier trap raised signal %d (%s), code %d.] >> Successful recovery is %sunlikely. >> Successful recovery is unlikely. >> Core dumps are disabled - Terminating normally. integer divide by 0 trapinteger overflow trapfloating-point overflow trapfloating-point underflow trapfloating-point inexact resultsubscript-range trapillegal opcode trapillegal operand trapillegal addressing mode trapillegal trapprivileged opcode trapprivileged register trapco-processor trapbad stack trapaddress not mapped to objectinvalid address alignmentnonexistent physical addressprocess breakpointprocess trace trapsignal sent by killsignal sent by sigqueueextremely >> [signal %d (%s), code %d] >> A %s has occurred. D = dump coreI = terminate immediatelyN = terminate normallyR = attempt recoveryQ = terminate normally   $ O  coliclCOLUMNSLINES SPCTABRETLFDESCDELcontrol-meta-`%s' (%s%s%c)`%s' %s dld_finalize_filedlopendlsymdlclose internal error: C stack exhausted internal error: C stack over-popped. Error status from fesetenv: %d No C-CALL-CONTINUE primitive! internal error: slipped in 1st part of callout internal error: slipped in 2nd part of callout Warning: punted callback #%ld. Missing primitives! Warning: punted callback #%ld. No room on stack! Warning: C data stack slipped in run-callback! internal error: slipped in callback kernel Warning: bogus callback handler: 0x%x. Warning: Callback did not return an integer! Warning: Callback returned an integer larger than a C long! Warning: Callback returned an integer larger than a C unsigned long! Warning: Callback did not return a real. Warning: Callback returned a real larger than a C double! Warning: Callback returned a bogus xstring. Warning: Callback did not return a pointer. Could not pop %d bytes. C-CALL-CONTINUERUN-CALLBACK The world image being restored is incompatible with this microcode. Can't allocate compiler_utilities. Error in make_compiler_utilities declare_builtin: malloc/realloc failed (size = %d). z y y y y z xz z z z z z Xz pz   asm_scheme_to_interfaceasm_scheme_to_interface_callasm_trampoline_to_interfaceasm_interrupt_procedureasm_interrupt_continuationasm_interrupt_closureasm_interrupt_dlinkasm_primitive_applyasm_primitive_lexpr_applyasm_assignment_trapasm_reference_trapasm_safe_reference_trapasm_linkasm_errorasm_primitive_errorasm_short_primitive_applyasm_generic_addasm_generic_subtractasm_generic_multiplyasm_generic_divideasm_generic_equalasm_generic_lessasm_generic_greaterasm_generic_incrementasm_generic_decrementasm_generic_zeroasm_generic_positiveasm_generic_negativeasm_generic_quotientasm_generic_remainderasm_generic_moduloasm_nofp_addasm_nofp_subtractasm_nofp_multiplyasm_nofp_divideasm_nofp_equalasm_nofp_lessasm_nofp_greaterasm_nofp_incrementasm_nofp_decrementasm_nofp_zeroasm_nofp_positiveasm_nofp_negativeasm_nofp_quotientasm_nofp_remainderasm_nofp_moduloasm_sc_applyasm_sc_apply_size_1asm_sc_apply_size_2asm_sc_apply_size_3asm_sc_apply_size_4asm_sc_apply_size_5asm_sc_apply_size_6asm_sc_apply_size_7asm_sc_apply_size_8asm_interrupt_continuation_2asm_serialize_cacheasm_dont_serialize_cacheasm_fixnum_shiftasm_set_interrupt_enables p X @ ( @   (ADDRESS) Treat ADDRESS, a Scheme integer corresponding to a C unsigned long, as a C char * pointer. Allocate and return a Scheme string with the same contents.(PROCEDURE ARG-LIST) Invokes PROCEDURE on the arguments in ARG-LIST.(object alist) These procedures find the first pair in ALIST whose car field is OBJECT, and return that pair; the returned pair is always an *element* of ALIST, *not* one of the pairs from which ALIST is composed. If no pair in ALIST has OBJECT as its car, `#f' (n.b.: not the empty list) is returned. `assq' uses `eq?' to compare OBJECT with the car fields of the pairs in ALIST, while `assv' uses `eqv?' and `assoc' uses `equal?'. (define e '((a 1) (b 2) (c 3))) (assq 'a e) => (a 1) (assq 'b e) => (b 2) (assq 'd e) => #f (assq (list 'a) '(((a)) ((b)) ((c)))) => #f (assoc (list 'a) '(((a)) ((b)) ((c)))) => ((a)) (assq 5 '((2 3) (5 7) (11 13))) => unspecified (assv 5 '((2 3) (5 7) (11 13))) => (5 7) Although they are often used as predicates, `assq', `assv', and `assoc' do not have question marks in their names because they return useful values rather than just `#t' or `#f'. (NAMESTRING) Load the contents of the file NAMESTRING into memory. The file was presumably made by a call to PRIMITIVE-FASDUMP, and may contain data for the heap and/or the pure area. The value returned is the object that was dumped.(BIT-STRING) BIT-STRING is converted to the appropriate non-negative integer. This operation is the inverse of `unsigned-integer->bit-string'.(BIT-STRING INDEX) Sets the indexed bit to zero, returning its previous value as a boolean.(BIT-STRING INITIALIZATION) Fills the bit string with zeros if the initialization is false, otherwise fills it with ones.(BIT-STRING) Returns the number of bits in BIT-STRING.(BIT-STRING INDEX) Returns the boolean value of the indexed bit.(BIT-STRING INDEX) Sets the indexed bit to one, returning its previous value as a boolean.(BIT-STRING) Returns true the argument has no "set" bits.(BIT-STRING-1 BIT-STRING-2) Returns true iff the two bit strings contain the same bits.(SOURCE START1 END1 DESTINATION START2) Destructively copies the substring of SOURCE between START1 and END1 into DESTINATION at START2. The copying is done from the MSB to the LSB (which only matters when SOURCE and DESTINATION are the same).(compiled-entry-object) Install a breakpoint trap in a compiled code object. Returns false or a handled needed by REMOVE-BKPT and ONE-STEP-PROCEED.(compiled-entry-object handle state) Proceed the computation from the current breakpoint.(compiled-entry-object handle) Remove a breakpoint trap installed by INSTALL-BKPT.(compiled-entry-object) True if there is a breakpoint trap in compiled-entry-object.(PROCEDURE) Invoke PROCEDURE with a copy of the current control stack.(pair) Returns the contents of the car field of PAIR. Note that it is an error to take the CAR of an empty list. (pair) Returns the contents of the cdr field of PAIR. Note that it is an error to take the CDR of an empty list. Return #F iff CHANNEL is in non-blocking mode. Otherwise, CHANNEL is in blocking mode. If CHANNEL can be put in non-blocking mode, #T is returned. If it cannot, 0 is returned.Put CHANNEL in non-blocking mode.Read characters from CHANNEL, storing them in STRING. Third and fourth args START and END specify the substring to use. Attempt to fill that substring unless end-of-file is reached. Return the number of characters actually read from CHANNEL.(CHANNEL) Synchronize CHANNEL with any permanent storage associated with it, forcing any buffered data to be written permanently.Return a vector of all channels in the channel table.Return (as a nonnegative integer) the type of CHANNEL.Return (as a string) the type of CHANNEL.Write characters to CHANNEL, reading them from STRING. Third and fourth args START and END specify the substring to use.(INTERRUPT-MASK) Clears the interrupt bits in INTERRUPT-MASK by clearing the corresponding bits in the interrupt code. See `get-interrupt-enables' for more information on interrupts.Given a compiled closure, return the entry point which it invokes.(ADDRESS) Given a compiled-code entry ADDRESS, return its block.(ADDRESS) Given a compiled-code entry ADDRESS, return its offset into its block.(obj1 obj2) Returns a newly allocated pair whose car is OBJ1 and whose cdr is OBJ2. The pair is guaranteed to be different (in the sense of EQV?) from other previously existing object. (OBJECT) Returns #T iff OBJECT is in constant space.Return Scheme's effective GID.Return Scheme's effective UID.Return the name of the current user's home directory.Return (as a string) the user name of the user running Scheme.A cheap, built-in printer intended for debugging the interpreter.Ensure cache coherence for a compiled-code block newly constructed.Fill a vector with the second argument decoded. The vector's elements are: #(TAG second minute hour day month year day-of-week dst zone)Create a new directory, called NAME.(INTERRUPT-MASK) Disables the interrupts specified in INTERRUPT-MASK by clearing the corresponding bits in the interrupt mask. Returns previous mask value. See `get-interrupt-enables' for more information on interrupts.(FILENAME WEAK-PAIR) Load the shared library FILENAME and store its handle in the cdr of WEAK-PAIR.(HANDLE STRING) Look up the symbol named STRING in the shared library specified by HANDLE. Return the symbol's address, or #F if no such symbol.(HANDLE) Unload the shared library specified by HANDLE. The file is unmapped from memory, and its symbols become unbound.(PROCEDURE NAMESTRING) Saves an image of the current world to the file NAMESTRING. When the file is reloaded, PROCEDURE is called with an argument of #F.(INTERRUPT-MASK) Enables the interrupts specified in INTERRUPT-MASK by setting the corresponding bits in the interrupt mask. Returns previous mask value. See `get-interrupt-enables' for more information on interrupts.Return the file time corresponding to the time structure given.Return the current time as an integer.(ENV1 ENV2 SYMBOL) SYMBOL must be bound in ENV2. Creates a new binding for SYMBOL in ENV1, such that the bindings in ENV1 and ENV2 share the same value cell. If SYMBOL is already bound in ENV1, the existing binding is modified.(MESSAGE IRRITANTS ENVIRONMENT) Signal an error.Exit Scheme with no option to restart.Exit Scheme with no option to restart, returning integer argument as exit status.Return #T iff FILENAME exists and is accessible according to MODE. MODE is an integer between 0 and 7 inclusive, bitwise encoded: 4 ==> file is readable; 2 ==> file is writable; 1 ==> file is executable.Given a file name, return attribute information about the file. If the file exists and its status information is accessible, the result is a vector of 10 items (see the reference manual for details). Otherwise the result is #F.Like FILE-ATTRIBUTES but indirect through symbolic links.Make a new copy of the file FROM-NAME, called TO-NAME.Return #T iff FILENAME refers to an existing directory. Otherwise #F is returned, meaning either that FILENAME doesn't exist or that it isn't a directory.True iff the two file arguments are the same file.Return #T iff FILENAME refers to an existing file. Return #F if the file doesn't exist. Return zero if it's a symbolic link. Signal an error if the file's existence is indeterminate.Return #T iff FILENAME refers to an existing file. Return #F if the file doesn't exist. Return zero if it's a symbolic link that points to a nonexisting file. Signal an error if the file's existence is indeterminate.Return the length of CHANNEL in characters.Create a hard link from file FROM-NAME to file TO-NAME. TO-NAME becomes another name for the file FROM-NAME.Create a soft link from file FROM-NAME to file TO-NAME. TO-NAME becomes a soft link containing the string FROM-NAME.Return mode bits of FILE, as an integer.Open an output file called FILENAME, returning a channel number. If the file exists, output is appended to its contents.Open an output file called FILENAME, returning a channel number. If the file exists, an error is signalled.Open an input file called FILENAME, returning a channel number.Open a file called FILENAME, returning a channel number. The file is opened for both input and output. If the file exists, its contents are not disturbed.Open an output file called FILENAME, returning a channel number. If the file exists, it is rewritten.Return the position of CHANNEL's file-pointer. This is a non-negative number strictly less than the file's length.Delete file FILENAME. If FILENAME is a soft link, the link is deleted.If file FILENAME is a link to another file (hard or soft), remove it.Rename file FROM-NAME to TO-NAME.Set the file-pointer of CHANNEL to POSITION. POSITION must be a non-negative number strictly less than the file's length.Iff FILENAME refers to an existing soft link, return the link contents. Otherwise #F is returned, meaning either that FILENAME doesn't exist or that it isn't a soft link.Convert a file system time stamp into a date/time string.Given a file name, change the times of the file to the current time. If the file does not exist, create it. Both the access time and modification time are changed. Return #F if the file existed and its time was modified. Otherwise the file did not exist and it was created.Set the length of CHANNEL to LENGTH. LENGTH must be a non-negative number.Return type of FILE, as an exact non-negative integer. Don't indirect through symbolic links.Return type of FILE, as an exact non-negative integer. Indirect through symbolic links.(STRING) Returns the symbol named STRING, or #F if no such symbol exists.(FIXNUM) Equivalent to (INTEGER->FLONUM FIXNUM 2)(PROMISE) Return the value memoized in PROMISE, computing it if it has not been memoized yet.Returns the full hostname (including domain if available) as a string.(SAFETY-MARGIN) Performs a garbage collection and returns the number of words available for further allocation. Also sets the "safety margin", which is the number of reserved words at the top of the heap, to SAFETY-MARGIN, which must be a non-negative integer. Finally, runs the primitive GC daemons before returning.(object path) This procedure is a generalization of `car' and `cdr'. PATH encodes a particular sequence of `car' and `cdr' operations, which `general-car-cdr' executes on OBJECT. PATH is an exact non-negative integer that encodes the operations in a bitwise fashion: a zero bit represents a `cdr' operation, and a one bit represents a `car'. The bits are executed LSB to MSB, and the most significant one bit, rather than being interpreted as an operation, signals the end of the sequence. For example, the following are equivalent: (general-car-cdr OBJECT #b1011) (cdr (car (car OBJECT))) Here is a partial table of path/operation equivalents: #b10 cdr #b11 car #b100 cddr #b101 cdar #b110 cadr #b111 caar #b1000 cdddr Note that PATH is restricted to a machine-dependent range, usually the size of a machine word. On many machines, this means that the maximum length of PATH will be 30 operations (32 bits, less the sign bit and the Look up the value of a variable in the user's shell environment. The argument, a variable name, must be a string. The result is either a string (the variable's value), or #F indicating that the variable does not exist.() Return the fixed objects vector (TM).Given HOST-NAME, return its internet host numbers. The result is a vector of strings, or #F if no such host exists.() Returns the current interrupt mask. There are two interrupt bit masks: - The interrupt mask has a one bit for every enabled interrupt. - The interrupt code has a one bit for every interrupt pending service. Interrupts are prioritized according to their bit position (LSB is highest). At any interrupt polling point, the highest enabled pending interrupt is serviced. The interrupt handler is a two-argument Scheme procedure invoked with all interrupts disabled and with the interrupt code and mask as arguments. The interrupt mask is restored on return from the interrupt handler. To prevent re-servicing the interrupt, the interrupt handler should clear the corresponding interrupt bit.Given a symbol NAME, return the primitive object of that name. ARITY is the number of arguments which the primitive should expect. If ARITY is #F, #F is returned if the primitive is not implemented, even if the name already exists. If ARITY is an integer, a primitive object will always be returned, whether the corresponding primitive is implemented or not.Return a pair of integers which are the number of primitive procedures. The car is the count of defined primitives; the cdr is the count of undefined primitives that are referenced.Return the (string) name of PRIMITIVE-PROCEDURE.Given SERVICE-NAME and PROTOCOL-NAME, return a port number. The result is a nonnegative integer, or #F if no such service exists.Given PORT-NUMBER, return it in the network encoding.Return the file name of a given user's home directory. The user name argument must be a string. If no such user is known, #F is returned.Return the group name corresponding to GID. If the argument is not a known group ID, #F is returned.Exit Scheme, suspending it to that it can be restarted.(N-WORDS) Tests to see if there are at least N-WORDS words of heap storage availableThe length of a host address string, in characters.Returns the hostname of the machine as a string.Given the tag of a compiled object, return the object.(ADDRESS PREFIX) Run the object-file initialization thunk specified by ADDRESS, using PREFIX as the rewriting prefix for the subparts.(ADDRESS) Treat ADDRESS, a Scheme integer corresponding to a C unsigned long, as the address of a C procedure of no arguments that returns an unsigned long. Invoke it, and return the corresponding Scheme integer.(list) Returns the length of LIST. (ASSIGNMENT ENVIRONMENT SYMBOL VALUE) Sets the value of the variable in ENVIRONMENT named SYMBOL to VALUE. Returns the previous value. Indistinguishable from evaluating (set! SYMBOL VALUE) in ENVIRONMENT.(ENVIRONMENT SYMBOL) Returns the value of the variable in ENVIRONMENT named SYMBOL. Indistinguishable from evaluating SYMBOL in ENVIRONMENT.(ENVIRONMENT SYMBOL) Returns a index integer indicating the type of object stored in the binding of SYMBOL within ENVIRONMENT. The following values are defined: 0 means unbound 1 means unassigned 2 means a normal binding 3 means a macro binding(ENVIRONMENT SYMBOL) Returns #T if the variable corresponding to SYMBOL is bound but has the special UNASSIGNED value in ENVIRONMENT. Returns #F otherwise. Does a complete lexical search for SYMBOL starting in ENVIRONMENT. The special form (unassigned? ) is built on top of this.(ENVIRONMENT SYMBOL) Returns #T if the variable corresponding to SYMBOL has no binding in ENVIRONMENT. Returns #F otherwise. Does a complete lexical search for SYMBOL starting in ENVIRONMENT.(ENVIRONMENT SYMBOL) Returns #T if looking up SYMBOL in ENVIRONMENT would cause an error. Returns #F otherwise.Return a vector containing the names of registered compiled-code blocks.This is an obsolete primitive. Use `file-link-hard' or `file-link-soft'. Create a new name for file FROM-NAME, called TO-NAME. If third arg HARD? is #F, a soft link is created; otherwise a hard link is created.(TARGET-ENV TARGET-NAME SOURCE-ENV SOURCE-NAME) Define a new binding for TARGET-NAME in TARGET-ENV, which shares its value cell with the binding for SOURCE-NAME in SOURCE-ENV. SOURCE-NAME must be bound in SOURCE-ENV.(list radix negative?) LIST is a non-null list of digits in RADIX, most-significant first. Converts the list to an integer. NEGATIVE? specifies the sign.Returns a list of the digits of BIGNUM in RADIX.(NAMESTRING) Restores the heap and constant space from the contents of the file NAMESTRING, which is typically a file created by DUMP-BAND. The file can, however, be any file which can be loaded with BINARY-FASLOAD.(ENVIRONMENT SYMBOL VALUE) [Should be called LEXICAL-DEFINE.] If the variable specified by SYMBOL already exists in the lexical ENVIRONMENT, then its value there is changed to VALUE. Otherwise a new binding is created in that environment linking the specified variable to the value. Returns SYMBOL. Indistinguishable from evaluating (define SYMBOL VALUE) in ENVIRONMENT.(REFERENCE ENVIRONMENT SYMBOL) Identical to LEXICAL_REFERENCE, here for hysterical reasons.(SIZE INITIALIZATION) Returns a bit string of the specified size with all the bits set to zero if the initialization is false, one otherwise.(DATUM) Convert the unsigned integer DATUM into a fixnum. Assert: (= (OBJECT-DATUM (MAKE-NON-POINTER-OBJECT X)) X).Return a cons of two channels, the reader and writer of a pipe.Create a subprocess. First arg FILENAME is the program to run. Second arg ARGV is a vector of strings to pass to the program as arguments. Third arg ENV is a vector of strings to pass as the program's environment; #F means inherit Scheme's environment. Fourth arg CTTY specifies the program's controlling terminal: #F means none; -1 means use Scheme's controlling terminal in background; -2 means use Scheme's controlling terminal in foreground; string means open that terminal. Fifth arg STDIN is the input channel for the subprocess. Sixth arg STDOUT is the output channel for the subprocess. Seventh arg STDERR is the error channel for the subprocess. Each channel arg can take these values: #F means none; -1 means use the corresponding channel from Scheme; -2 means use the controlling terminal (valid only when CTTY is a string); otherwise the argument must be a channel.For return codes and primitives, this returns the internal representation of the return address or primitive address given the external representation. This accepts two arguments, TYPE-CODE and VALUE-CODE. TYPE-CODE is the microcode type of the object to be returned; it must be either a return address or primitive procedure type. VALUE-CODE is the index number (i.e. external representation) of the desired result.This is the inverse operation of `map-code-to-machine-address'. Given a machine ADDRESS and a TYPE-CODE (either return code or primitive procedure), it finds the number for the external representation for the internal address.(object list) Returns the first pair of LIST whose car is OBJECT; the returned pair is always one from which LIST is composed. If OBJECT does not occur in LIST, `#f' (n.b.: not the empty list) is returned. `memq' uses `eq?' to compare OBJECT with the elements of LIST, while `memv' uses `eqv?' and `member' uses `equal?'. (memq 'a '(a b c)) => (a b c) (memq 'b '(a b c)) => (b c) (memq 'a '(b c d)) => #f (memq (list 'a) '(b (a) c)) => #f (member (list 'a) '(b (a) c)) => ((a) c) (memq 101 '(100 101 102)) => unspecified (memv 101 '(100 101 102)) => (101 102) Although they are often used as predicates, `memq', `memv', and `member' do not have question marks in their names because they return useful values rather than just `#t' or `#f'. Open the directory NAME for reading, returning a directory number.Read and return a filename from DIRECTORY, or #F if no more files.Read and return a filename from DIRECTORY. The filename must begin with the STRING. Return #F if there are no more matching files in the directory.Open an output file called FILENAME. The channel number is saved in the cdr of WEAK-PAIR. If the file exists, output is appended to its contents.Open an output file called FILENAME. The channel number is saved in the cdr of WEAK-PAIR. If the file exists, an error is signalled.Open an input file called FILENAME. The channel number is saved in the cdr of WEAK-PAIR.Open a file called FILENAME. The channel number is saved in the cdr of WEAK-PAIR. The file is opened for both input and output. If the file exists, its contents are not disturbed.Open an output file called FILENAME. The channel number is saved in the cdr of WEAK-PAIR. If the file exists, it is rewritten.Store the reader and writer of a new pipe in the cdrs of weak pairs.Given PORT-NUMBER, open TCP server socket. The opened socket is stored in the cdr of WEAK-PAIR.Given HOST-ADDRESS and PORT-NUMBER, open a TCP stream socket. The opened socket is stored in the cdr of WEAK-PAIR.Open the unix stream socket FILENAME. The opened socket is stored in the cdr of WEAK-PAIR.Poll SERVER-SOCKET for a connection. If a connection is available, it is opened and #T is returned; the opened socket is stored in the cdr of WEAK-PAIR. Otherwise, if SERVER-SOCKET is non-blocking, returns #F. Second argument PEER-ADDRESS, if not #F, must be a host address string. It is filled with the peer's address if given.Open a PTY master, returning the master's channel and the slave's name. Returns a vector #(CHANNEL MASTER-NAME SLAVE-NAME).(object) Returns #t if object is a pair; otherwise returns #f.(ADDRESS) Return the object datum corresponding to ADDRESS.(DATUM) Return the memory address corresponding to DATUM.(OBJECT NAMESTRING FLAG) Writes a binary representation of OBJECT to the file NAMESTRING. Returns #T if the operation is successful, or #F otherwise. FLAG specifies how to handle environment objects that OBJECT points to: #F means generate an error; #T means write them as ordinary objects; any other value is like #F except that environments pointed at by compiled code are ignored (and discarded).(TYPE-CODE) Return the value of the free pointer tagged with TYPE-CODE(OBJECT) Remove OBJECT from pure space, allowing it to be modified.(N-WORDS) Advance the free pointer by N-WORDS words.(INTEGER) Return the object whose representation is INTEGER.(TYPE DATUM) Return a new object made from TYPE and DATUM.(OBJECT) Return the integer representation of OBJECT.(OBJECT) Return the address part of OBJECT as an unsigned integer.Return the datum part of OBJECT as an unsigned integer.(TYPE OBJECT) Return a new object made from TYPE and the datum part of OBJECT.Return the type code of OBJECT as an unsigned integer.Return #T if TYPE-CODE is OBJECT's type code, else #F.Given a primitive procedure, returns the number of arguments it requires.Given a primitive procedure, return its documentation string.(OBJECT PURE? SAFETY-MARGIN) Copy OBJECT from the heap into constant/pure space. PURE? is ignored.Continues process PROCESS-NUMBER in the background.Continues process PROCESS-NUMBER in the foreground. The process must have the same controlling terminal as Scheme.Delete process PROCESS-NUMBER from the process table.Sends the hangup signal to process PROCESS-NUMBER (unix SIGHUP).Return the process ID of process PROCESS-NUMBER.Interrupts process PROCESS-NUMBER (unix SIGINT).Returns the job-control status of process PROCESS-NUMBER: 0 means this system doesn't support job control. 1 means the process doesn't have the same controlling terminal as Scheme. 2 means it's the same ctty but the OS doesn't have job control. 3 means it's the same ctty and the OS has job control.Kills process PROCESS-NUMBER (unix SIGKILL).Sends the quit signal to process PROCESS-NUMBER (unix SIGQUIT).Return the termination reason of process PROCESS-NUMBER. This is a nonnegative integer, which depends on the process's status: running => zero; stopped => the signal that stopped the process; exited => the exit code returned by the process; signalled => the signal that killed the process. The value is from the last synchronization.Send a signal to process PROCESS-NUMBER; second arg SIGNAL says which one.Return the status of process PROCESS-NUMBER, a nonnegative integer: 0 = running; 1 = stopped; 2 = exited; 3 = signalled. The value is from the last synchronization.Synchronize the status of process PROCESS-NUMBER. Return #F if it was previously synchronized, #T if not.Stops process PROCESS-NUMBER (unix SIGTSTP).Return a vector of all processes in the process table.Set the process timer. First arg FIRST says how long to wait until the first interrupt; second arg INTERVAL says how long to wait between interrupts after that. Both arguments are in units of milliseconds.Waits until process PROCESS-NUMBER is not running.Set the profile timer. First arg FIRST says how long to wait until the first interrupt; second arg INTERVAL says how long to wait between interrupts after that. Both arguments are in units of milliseconds.Send a signal to PTY-MASTER; second arg says which one.(OBJECT) Returns #T iff OBJECT is in constant space and is 'pure'.(POINTER OFFSET BIT-STRING) Read the contents of memory at the address (POINTER,OFFSET) into BIT-STRING.(ADDRESS) Read a byte from memory at ADDRESS and return it as an unsigned integer.(ADDRESS) Read a float from memory at ADDRESS and return it as a flonum.(ADDRESS) Read a word from memory at ADDRESS and return it as an unsigned integer.Return the current real time in units of milliseconds.Set the real timer. First arg FIRST says how long to wait until the first interrupt; second arg INTERVAL says how long to wait between interrupts after that. Both arguments are in units of milliseconds.() Return the filename from which the runtime system was last restored. The result is a string, or #F if the system was not restored.(INTERRUPT-MASK) Requests the interrupt bits in INTERRUPT-MASK by setting the corresponding bits in the interrupt code. See `get-interrupt-enables' for more information on interrupts.(THUNK PROCEDURE . ARGS) Invokes THUNK with no arguments and a special return address. The return address calls PROCEDURE on ARGS. This is used by the runtime system to create stack frames that can be identified by the continuation parser.(ENVIRONMENT SYMBOL) Looks up SYMBOL in ENVIRONMENT and returns its value. If the variable is unbound, signals an error. If the variable is unassigned or holds a macro transformer, returns the appropriate trap object.(SCODE-EXPRESSION ENVIRONMENT) Evaluate SCODE-EXPRESSION in ENVIRONMENT.(pair object) Store OBJECT in the car field of PAIR. The value returned by SET-CAR! is unspecified. (pair object) Store OBJECT in the cdr field of PAIR. The value returned by SET-CDR! is unspecified. (HISTORY) Set the interpreter's history object to HISTORY.Set the mode bits of FILE to MODE.Change the access and modification times of FILE. The second and third arguments are the respective times. The file must exist and you must be the owner (or superuser).(NEW-FOV) Set the fixed objects vector (TM) to NEW-FOV.(INTERRUPT-MASK) Sets the interrupt mask to INTERRUPT-MASK; returns previous mask value. See `get-interrupt-enables' for more information on interrupts.Change the current working directory to NAME.This is an obsolete primitive; use `process-timer-set' instead.(STRING) Returns the interned symbol named STRING, constructing a new symbol if needed.(STRING) Returns the hash value for STRING, using the hashing algorithm for interning symbols.(STRING DENOMINATOR) DENOMINATOR must be a nonnegative integer. Equivalent to (MODULO (STRING-HASH STRING) DENOMINATOR).Invoke sh (the Bourne shell) on the string argument. Wait until the shell terminates, returning its exit status as an integer.Return the current process time in units of milliseconds.Put TERMINAL into buffered mode.Return #F iff TERMINAL is not in buffered mode.Put TERMINAL into cooked output mode.Return #F iff TERMINAL is not in cooked output mode.Wait until all characters in TERMINAL's output buffer have been sent.Discard any characters in TERMINAL's input buffer.Discard any characters in TERMINAL's output buffer.Put TERMINAL into nonbuffered mode.Put TERMINAL into raw output mode.Return a string that, when written to the display, will make it beep.Return a string that, when written to the display, will clear it.Return the current interrupt characters as a string.Return the current keyboard interrupt enables.Return the standard input channel.Return the next interrupt character in the console input buffer. The character is returned as an unsigned integer.Return the standard output channel.Change the current interrupt characters to STRING. STRING must be in the correct form for this operating system.Change the keyboard interrupt enables to MASK.Return the display width in character columns.Return the display height in character lines.Return the user name corresponding to UID. If the argument is not a known user ID, #F is returned.(ENVIRONMENT SYMBOL) Unbind the variable SYMBOL in ENVIRONMENT. Returns #F if the variable was not previously bound, otherwise #T.(LENGTH INTEGER) INTEGER, which must be a non-negative integer, is converted to a bit-string of length LENGTH. If INTEGER is too large, an error is signalled.(FILENAME ARGV ENV WORK-DIR STDIN STDOUT STDERR) Create a subprocess. FILENAME is the program to run. ARGV is a vector of strings to pass to the program as arguments. ENV is a vector of strings to pass as the program's environment; #F means inherit Scheme's environment. WORK-DIR is a string to pass as the program's working directory; #F means inherit Scheme's working directory. CTTY specifies the program's controlling terminal: #F means none; -1 means use Scheme's controlling terminal in background; -2 means use Scheme's controlling terminal in foreground; string means open that terminal. STDIN is the input channel for the subprocess. STDOUT is the output channel for the subprocess. STDERR is the error channel for the subprocess. Each channel arg can take these values: #F means none; -1 means use the corresponding channel from Scheme; -2 means use the controlling terminal (valid only when CTTY is a string); otherwise the argument must be a channel.Validate the heap. Complains if a scan of the heap encounters anything unexpected. Returns #T if the scan was successful and #F if there were any complaints.(THUNK) Execute THUNK with the interpreter's history OFF.(MASK RECEIVER) Set the interrupt mask to MASK for the duration of the call to RECEIVER. RECEIVER is passed the old interrupt mask as its argument.(MASK RECEIVER) Like WITH-INTERRUPT-MASK, but only disables interrupts.(THUNK MARKER1 MARKER2) Call THUNK with a continuation that has a special marker. When THUNK returns, the marker is discarded. The value of THUNK is returned to the continuation of this primitive. The marker consists of MARKER1 and MARKER2. By convention, MARKER1 is a tag identifying the kind of marker, and MARKER2 is data identifying the marker instance.(CONTROL-POINT THUNK) Invoke THUNK with CONTROL-POINT as its control stack.Return the current working directory as a string.(POINTER OFFSET BIT-STRING) Write the contents of BIT-STRING in memory at the address (POINTER,OFFSET).(BYTE ADDRESS) Write BYTE to memory at ADDRESS.(FLOAT ADDRESS) Write FLOAT to memory at ADDRESS.(WORD ADDRESS) Write WORD to memory at ADDRESS.BIT-SUBSTRING-FIND-NEXT-SET-BITCALL-WITH-CURRENT-CONTINUATIONCAST-IEEE754-DOUBLE-TO-INTEGERCAST-IEEE754-SINGLE-TO-INTEGERCAST-INTEGER-TO-IEEE754-DOUBLECAST-INTEGER-TO-IEEE754-SINGLEFLOAT-DIVIDE-BY-ZERO-EXCEPTIONFLOAT-INEXACT-RESULT-EXCEPTIONFLOAT-INVALID-OPERATION-EXCEPTIONINSTRUCTION-ADDRESS->COMPILED-CODE-BLOCKNEW-FILE-OPEN-EXCLUSIVE-OUTPUT-CHANNELNEW-TCP-SERVER-CONNECTION-ACCEPTPRIMITIVE-PROCEDURE-DOCUMENTATIONSET-WORKING-DIRECTORY-PATHNAME!SUBSTRING-FIND-NEXT-CHAR-IN-SETSUBSTRING-FIND-PREVIOUS-CHAR-IN-SETVECTOR-8B-FIND-PREVIOUS-CHAR-CI(BIT-STRING START END)Put CHANNEL in blocking mode.Close file CHANNEL-NUMBER.Return Scheme's PID.Delete directory called NAME.Close DIRECTORY.Turn off the process timer.Turn off the profile timer.Return Scheme's real GID.Turn off the real timer.Return Scheme's real UID.(FLAG_NUMBER BOOLEAN)%RECORD%RECORD-LENGTH%RECORD-REF%RECORD-SET!%RECORD?&*&+&-&/&<&=&>-1+ADD-TO-SELECT-REGISTRYADDRESS-TO-STRINGASCII->CHARASSQBATCH-MODE?BAUD-INDEX->RATEBAUD-RATE->INDEXBIGNUM->FIXNUMBIGNUM->FLONUMBIGNUM-ADDBIGNUM-DIVIDEBIGNUM-EQUAL?BIGNUM-LENGTH-IN-BITSBIGNUM-LESS?BIGNUM-MULTIPLYBIGNUM-NEGATIVE?BIGNUM-POSITIVE?BIGNUM-QUOTIENTBIGNUM-REMAINDERBIGNUM-SUBTRACTBIGNUM-ZERO?BIND-TCP-SERVER-SOCKETBIT-STRING->UNSIGNED-INTEGERBIT-STRING-ALLOCATEBIT-STRING-AND!BIT-STRING-ANDC!BIT-STRING-CLEAR!BIT-STRING-FILL!BIT-STRING-LENGTHBIT-STRING-MOVE!BIT-STRING-MOVEC!BIT-STRING-OR!BIT-STRING-REFBIT-STRING-SET!BIT-STRING-XOR!BIT-STRING-ZERO?BIT-STRING=?BIT-STRING?BIT-SUBSTRING-MOVE-RIGHT!BKPT/INSTALLBKPT/PROCEEDBKPT/REMOVEBKPT?BUILTIN-INDEX->NAMEC-CALLC-FREEC-MALLOCC-PEEK-BYTESC-PEEK-CHARC-PEEK-CSTRINGC-PEEK-CSTRING!C-PEEK-CSTRINGPC-PEEK-CSTRINGP!C-PEEK-DOUBLEC-PEEK-FLOATC-PEEK-INTC-PEEK-LONGC-PEEK-POINTERC-PEEK-SHORTC-PEEK-UCHARC-PEEK-UINTC-PEEK-ULONGC-PEEK-USHORTC-POKE-BYTESC-POKE-CHARC-POKE-DOUBLEC-POKE-FLOATC-POKE-INTC-POKE-LONGC-POKE-POINTERC-POKE-POINTER!C-POKE-SHORTC-POKE-STRINGC-POKE-STRING!C-POKE-UCHARC-POKE-UINTC-POKE-ULONGC-POKE-USHORTCANONICAL-HOST-NAMECC-BLOCK-LINKAGE-INFOCELL-CONTENTSCELL?CHANNEL-BLOCKINGCHANNEL-BLOCKING?CHANNEL-DESCRIPTORCHANNEL-FILE-ATTRIBUTESCHANNEL-NONBLOCKINGCHANNEL-READCHANNEL-SYNCHRONIZECHANNEL-TABLECHANNEL-TYPECHANNEL-TYPE-NAMECHANNEL-WRITECHAR->ASCIICHAR->INTEGERCHAR->SYNTAX-CODECHAR-ASCII?CHAR-BITSCHAR-CODECHAR-DOWNCASECHAR-UPCASECLEAR-FLOAT-EXCEPTIONSCLEAR-INTERRUPTS!CLOSE-LOST-OPEN-FILESCOERCE-TO-COMPILED-PROCEDURECOMPILED-CLOSURE->ENTRYCOMPILED-CODE-ADDRESS->BLOCKCOMPILED-CODE-ADDRESS->OFFSETCOMPILED-ENTRY-KINDCONSTANT?CREATE-TCP-SERVER-SOCKETCURRENT-GIDCURRENT-PIDCURRENT-UIDCURRENT-USER-HOME-DIRECTORYCURRENT-USER-NAMEDEALLOCATE-EXTERNAL-STRINGDEALLOCATE-SELECT-REGISTRYDEBUGGING-PRINTERDECLARE-COMPILED-CODE-BLOCKDECODE-TIMEDECODE-UTCDEFER-FLOAT-EXCEPTION-TRAPSDIRECTORY-DELETEDISABLE-INTERRUPTS!DIVIDE-FIXNUMDLD-LOAD-FILEDLD-LOOKUP-SYMBOLDLD-UNLOAD-FILEDUMP-BANDENABLE-INTERRUPTS!ENCODE-TIMEENVIRONMENT-LINK-NAMEEQUAL-FIXNUM?ERROR-PROCEDUREEXITEXIT-WITH-VALUEEXTENDED-STRING-LENGTHEXTERNAL-STRING?FILE-ACCESSFILE-ACCESS-TIMEFILE-ACCESS-TIME-INDIRECTFILE-ATTRIBUTES-INDIRECTFILE-DIRECTORY?FILE-EQ?FILE-EXISTS-DIRECT?FILE-EXISTS?FILE-LENGTH-NEWFILE-LINK-HARDFILE-LINK-SOFTFILE-MOD-TIMEFILE-MOD-TIME-INDIRECTFILE-MODESFILE-POSITIONFILE-REMOVE-LINKFILE-SET-POSITIONFILE-SYSTEM-TYPEFILE-TIME->STRINGFILE-TOUCHFILE-TRUNCATEFILE-TYPE-DIRECTFILE-TYPE-INDIRECTFIND-SYMBOLFIXNUM->BIGNUMFIXNUM->FLONUMFIXNUM-ANDFIXNUM-ANDCFIXNUM-LSHFIXNUM-NEGATEFIXNUM-NOTFIXNUM-ORFIXNUM-QUOTIENTFIXNUM-REMAINDERFIXNUM-XORFLOAT-OVERFLOW-EXCEPTIONFLOAT-ROUNDING-MODESFLOAT-UNDERFLOW-EXCEPTIONFLOATING-VECTOR-CONSFLOATING-VECTOR-LENGTHFLOATING-VECTOR-REFFLOATING-VECTOR-SET!FLONUM->BIGNUMFLONUM-ABSFLONUM-ACOSFLONUM-ADDFLONUM-ASINFLONUM-ATANFLONUM-ATAN2FLONUM-CEILINGFLONUM-CEILING->EXACTFLONUM-COSFLONUM-DENORMALIZEFLONUM-DIVIDEFLONUM-EQUAL?FLONUM-EXPFLONUM-EXPM1FLONUM-EXPTFLONUM-FLOORFLONUM-FLOOR->EXACTFLONUM-GREATER?FLONUM-INTEGER?FLONUM-LESS?FLONUM-LOGFLONUM-LOG1PFLONUM-MODULOFLONUM-MULTIPLYFLONUM-NEGATEFLONUM-NEGATIVE?FLONUM-NORMALIZEFLONUM-POSITIVE?FLONUM-ROUNDFLONUM-ROUND->EXACTFLONUM-SINFLONUM-SQRTFLONUM-SUBTRACTFLONUM-TANFLONUM-TRUNCATEFLONUM-TRUNCATE->EXACTFLONUM-ZERO?FLONUM?FORCEFULL-HOSTNAMEGARBAGE-COLLECTGC-SPACE-STATUSGC-TRACE-REFERENCESGCD-FIXNUMGENERAL-CAR-CDRGET-COMMAND-LINEGET-ENVIRONMENT-VARIABLEGET-FIXED-OBJECTS-VECTORGET-FLOAT-ROUNDING-MODEGET-HOST-BY-ADDRESSGET-HOST-BY-NAMEGET-HOST-NAMEGET-PRIMITIVE-ADDRESSGET-PRIMITIVE-COUNTSGET-PRIMITIVE-NAMEGET-SERVICE-BY-NAMEGET-SERVICE-BY-NUMBERGET-UNUSED-COMMAND-LINEGET-USER-HOME-DIRECTORYGID->STRINGGREATER-THAN-FIXNUM?HALTHAVE-PTYS?HAVE-SELECT?HEAP-AVAILABLE?HOST-ADDRESS-ANYHOST-ADDRESS-LENGTHHOST-ADDRESS-LOOPBACKHUNK3-CONSHUNK3-CXRHUNK3-SET-CXR!INDEX-FIXNUM?INITIALIZE-C-COMPILED-BLOCKINITIALIZE-LIARC-OBJECT-FILEINTEGER->CHARINTEGER->FLONUMINTEGER-BIT-COUNTINTEGER-BITWISE-ANDINTEGER-BITWISE-ANDC1INTEGER-BITWISE-ANDC2INTEGER-BITWISE-EQVINTEGER-BITWISE-IORINTEGER-BITWISE-NANDINTEGER-BITWISE-NORINTEGER-BITWISE-NOTINTEGER-BITWISE-ORC1INTEGER-BITWISE-ORC2INTEGER-BITWISE-XORINTEGER-DIVIDEINTEGER-FIRST-SET-BITINTEGER-HAMMING-DISTANCEINTEGER-LENGTHINTEGER-LENGTH-IN-BITSINTEGER-NEGATEINTEGER-NEGATIVE-ZERO-BITSINTEGER-NONNEGATIVE-ONE-BITSINTEGER-QUOTIENTINTEGER-REMAINDERINTEGER-SHIFT-LEFTINTEGER-SHIFT-RIGHTINVOKE-C-THUNKLESS-THAN-FIXNUM?LEXICAL-ASSIGNMENTLEXICAL-REFERENCE-TYPELEXICAL-UNASSIGNED?LEXICAL-UNBOUND?LEXICAL-UNREFERENCEABLE?LIARC-COMPILED-BLOCKSLINK-FILELINK-VARIABLESLIST->INTEGERLIST->VECTORLISTEN-TCP-SERVER-SOCKETLISTIFY-BIGNUMLOCAL-ASSIGNMENTLOCAL-REFERENCEMACOSX-MAIN-BUNDLE-DIRMAKE-BIT-STRINGMAKE-CELLMAKE-CHARMAKE-EPHEMERONMAKE-NON-POINTER-OBJECTMAP-CODE-TO-MACHINE-ADDRESSMAP-MACHINE-ADDRESS-TO-CODEMEMQMICROCODE-IDENTIFYMICROCODE-LIBRARY-PATHMINUS-FIXNUMMINUS-ONE-PLUS-FIXNUMMULTIPLY-FIXNUMNANOTIME-SINCE-UTC-EPOCHNEGATIVE-FIXNUM?NEW-DIRECTORY-CLOSENEW-DIRECTORY-OPENNEW-DIRECTORY-READNEW-DIRECTORY-READ-MATCHINGNEW-FILE-OPEN-APPEND-CHANNELNEW-FILE-OPEN-INPUT-CHANNELNEW-FILE-OPEN-IO-CHANNELNEW-FILE-OPEN-OUTPUT-CHANNELNEW-MAKE-PIPENEW-OPEN-TCP-SERVER-SOCKETNEW-OPEN-TCP-STREAM-SOCKETNEW-OPEN-UNIX-STREAM-SOCKETNULL?OBJECT-GC-TYPEOPEN-PTY-MASTEROS-JOB-CONTROL?OUTF-ERRORPOSITIVE-FIXNUM?PRIMITIVE-ADDRESS->DATUMPRIMITIVE-APPLY-STEPPRIMITIVE-DATUM->ADDRESSPRIMITIVE-EVAL-STEPPRIMITIVE-FASDUMPPRIMITIVE-GET-FREEPRIMITIVE-IMPURIFYPRIMITIVE-INCREMENT-FREEPRIMITIVE-INTEGER->OBJECTPRIMITIVE-MAKE-OBJECTPRIMITIVE-OBJECT->INTEGERPRIMITIVE-OBJECT-ADDRESSPRIMITIVE-OBJECT-DATUMPRIMITIVE-OBJECT-EQ?PRIMITIVE-OBJECT-SET!PRIMITIVE-OBJECT-TYPEPRIMITIVE-OBJECT-TYPE?PRIMITIVE-PROCEDURE-ARITYPRIMITIVE-PURIFYPRIMITIVE-RETURN-STEPPROCESS-CONTINUE-BACKGROUNDPROCESS-CONTINUE-FOREGROUNDPROCESS-DELETEPROCESS-HANGUPPROCESS-IDPROCESS-INTERRUPTPROCESS-JOB-CONTROL-STATUSPROCESS-KILLPROCESS-QUITPROCESS-REASONPROCESS-SIGNALPROCESS-STATUSPROCESS-STATUS-SYNCPROCESS-STATUS-SYNC-ALLPROCESS-STOPPROCESS-TABLEPROCESS-TIMER-CLEARPROCESS-TIMER-SETPROCESS-WAITPROFILE-TIMER-CLEARPROFILE-TIMER-SETPTY-MASTER-CONTINUEPTY-MASTER-HANGUPPTY-MASTER-INTERRUPTPTY-MASTER-KILLPTY-MASTER-QUITPTY-MASTER-SEND-SIGNALPTY-MASTER-STOPPURE?QUOTED-CHAR?RAISE-FLOAT-EXCEPTIONSRE-CHAR-SET-ADJOIN!RE-COMPILE-FASTMAPRE-MATCH-BUFFERRE-MATCH-SUBSTRINGRE-SEARCH-BUFFER-BACKWARDRE-SEARCH-BUFFER-FORWARDRE-SEARCH-SUBSTRING-BACKWARDRE-SEARCH-SUBSTRING-FORWARDREAD-BITS!READ-BYTE-FROM-MEMORYREAD-FLOAT-FROM-MEMORYREAD-WORD-FROM-MEMORYREAL-GIDREAL-TIME-CLOCKREAL-TIMER-CLEARREAL-TIMER-SETREAL-UIDREHASHRELOAD-BAND-NAMERELOAD-RETRIEVE-STRINGRELOAD-SAVE-STRINGREMOVE-FROM-SELECT-REGISTRYREQUEST-INTERRUPTS!RESTORE-FLOAT-EXCEPTION-FLAGSRETURN-TO-APPLICATIONSAFE-LEXICAL-REFERENCESAVE-FLOAT-EXCEPTION-FLAGSSCAN-BACKWARD-PREFIX-CHARSSCAN-FORWARD-PREFIX-CHARSSCAN-FORWARD-TO-WORDSCAN-LIST-BACKWARDSCAN-LIST-FORWARDSCAN-SEXPS-FORWARDSCAN-WORD-BACKWARDSCAN-WORD-FORWARDSCHEME-ENVIRONMENTSCHEME-PROGRAM-NAMESELECT-REGISTRY-LENGTHSET-CELL-CONTENTS!SET-CURRENT-HISTORY!SET-DEBUG-FLAGS!SET-FILE-MODES!SET-FILE-TIMES!SET-FIXED-OBJECTS-VECTOR!SET-FLOAT-ENVIRONMENTSET-FLOAT-ROUNDING-MODESET-INTERRUPT-ENABLES!SET-STRING-LENGTH!SET-STRING-MAXIMUM-LENGTH!SET-TRAP-STATE!SET-TRAPPED-FLOAT-EXCEPTIONSSETUP-TIMER-INTERRUPTSHUTDOWN-SOCKETSTACK-ADDRESS-OFFSETSTACK-TOP-ADDRESSSTRING->SYMBOLSTRING->SYNTAX-ENTRYSTRING-HASHSTRING-HASH-MODSTRING-MAXIMUM-LENGTHSUBSTRING-CI=?SUBSTRING-DOWNCASE!SUBSTRING-MATCH-BACKWARDSUBSTRING-MATCH-BACKWARD-CISUBSTRING-MATCH-FORWARDSUBSTRING-MATCH-FORWARD-CISUBSTRING-MOVE-LEFT!SUBSTRING-UPCASE!SUBSTRINGLISTSUBVECTOR-FILL!SUBVECTOR-MOVE-LEFT!SUBVECTOR-MOVE-RIGHT!SYSTEMSYSTEM-CALL-ERROR-MESSAGESYSTEM-CLOCKSYSTEM-HUNK3-CXR0SYSTEM-HUNK3-CXR1SYSTEM-HUNK3-CXR2SYSTEM-HUNK3-SET-CXR0!SYSTEM-HUNK3-SET-CXR1!SYSTEM-HUNK3-SET-CXR2!SYSTEM-LIST-TO-VECTORSYSTEM-PAIR-CARSYSTEM-PAIR-CDRSYSTEM-PAIR-CONSSYSTEM-PAIR-SET-CAR!SYSTEM-PAIR-SET-CDR!SYSTEM-PAIR?SYSTEM-SUBVECTOR-TO-LISTSYSTEM-VECTOR-REFSYSTEM-VECTOR-SET!SYSTEM-VECTOR-SIZESYSTEM-VECTOR?TERMCAP-GET-FLAGTERMCAP-GET-NUMBERTERMCAP-GET-STRINGTERMCAP-GOTO-STRINGTERMCAP-INITIALIZETERMCAP-PAD-STRINGTERMCAP-PARAM-STRINGTERMINAL-BUFFEREDTERMINAL-BUFFERED?TERMINAL-COOKED-OUTPUTTERMINAL-COOKED-OUTPUT?TERMINAL-DRAIN-OUTPUTTERMINAL-FLUSH-INPUTTERMINAL-FLUSH-OUTPUTTERMINAL-GET-ISPEEDTERMINAL-GET-OSPEEDTERMINAL-GET-STATETERMINAL-NONBUFFEREDTERMINAL-RAW-OUTPUTTERMINAL-SET-ISPEEDTERMINAL-SET-OSPEEDTERMINAL-SET-STATETEST-FLOAT-EXCEPTION-FLAGSTEST-FLOAT-EXCEPTIONSTEST-SELECT-DESCRIPTORTEST-SELECT-REGISTRYTRAPPABLE-FLOAT-EXCEPTIONSTTY-COMMAND-BEEPTTY-COMMAND-CLEARTTY-GET-INTERRUPT-CHARSTTY-GET-INTERRUPT-ENABLESTTY-INPUT-CHANNELTTY-OUTPUT-CHANNELTTY-SET-INTERRUPT-CHARS!TTY-SET-INTERRUPT-ENABLESTYPE->GC-TYPEUID->STRINGUNBIND-VARIABLEUNDER-EMACS?UNSIGNED-INTEGER->BIT-STRINGUNTRAP-FLOAT-EXCEPTIONSUPDATE-FLOAT-ENVIRONMENTUTILITY-INDEX->NAMEUX-MAKE-SUBPROCESSVECTOR-8B-FILL!VECTOR-8B-FIND-NEXT-CHARVECTOR-8B-FIND-NEXT-CHAR-CIVECTOR-8B-FIND-PREVIOUS-CHARVECTOR-8B-REFVECTOR-8B-SET!VERIFY-HEAPWITH-HISTORY-DISABLEDWITH-INTERRUPT-MASKWITH-INTERRUPTS-REDUCEDWITH-STACK-MARKERWITHIN-CONTROL-POINTWORKING-DIRECTORY-PATHNAMEWRITE-BITS!WRITE-BYTE-TO-MEMORYWRITE-FLOAT-TO-MEMORYWRITE-WORD-TO-MEMORYZERO-FIXNUM?INEXISTENT-PRIMITIVE;505<<>>>D,?tV?t??4Y$D54D 6tD$6D<6DP6$Eh6TE|6E6E64F6dF6F 7F 74G47GH7G`7H7tH7H7tI7I7J8TJ<8JP84Kd8Kx8K8L8TL8DM8M9N,9DNL9Nl9N9O9TP9P(:$Rp:R:S:T(;UP;W|;X;4Z;[<\D<\h<]<^<^<_=`D=tat=Tb=4c=d>d4>ed>f>g>g>$h>i(?Tj`?m?dm?n?Dx4@Dy`@z@t}@4~$AtdATAԁA$BtdBDB4BąC\C4C D4TDDtDĒDET(EDXEtlEEE F4`FdFFTGԞGdGGHpHHH IdIĭIIJTtJijJJԴK\KTKKD8LDtLL8MdMMPN4tN4NN OOdOTP@PlPtP0QdpQtQQQ$QdQR$0RtLRhRRRRTRS40SdLShSSS$SDStdTTT$TtTT4U@U\UTUUDUVdDVtVdVVdWDWd|WWDXtdXDXXDXYTYlYYYY8Z`Z4ZTZZZZ$ZT[4[P[h[[4[[[\d$\@\l\\D\]T"<]"l]$]D%]t%^%D^$&d^T&|^D'^(^)_$)$_d*d_t*x_*_*_*_$,_- `-D`4.``T/`t/`D0ad0(a0@a0`a0ad1a1a42(b3|bt3b3bD4b4c4 c45eBeDBedBf4D0ftDPfDhfDfTGfGfGfHfDHgH0gH`gIgDIgIgIgIgIhTK8hdKLhKdhK|h4LhLhTMiQxiQidRiTj4T0jTTDjTpjTjWjYj$YjTYkY,kYHkZdkZkZkd[k[k$\k\ l$](l]Dl^pl^l`l`lTalamDb,mbHmbdm4cmdcmcm4dmTdmtd nd0nTeLnepnDfndfnfntgngogog0ogDogXoglogoDhoho4ioioi pj(pjDpTktpkptlpTmpmpmqn q$o@@$@PTA|AtB4CCDD|EE$FdF tF F4$G`tGGHdHH I,TILdI`4JJJJKK L$ L8 $LL DL` Lt L L 4M M N 4N $O\ 4P 4V X TX \ ] $]( ]< ^T ta| a a a Tb c c$ d8 $dP Ddh Td| dd Te de e g$ 4g< g` g 4i tj$s4sdst$tttuduvHwltxyzd{4|DT|\t||}D~d~0~DdTԀ0TLhԁԂT8$\D4<Ԇ`$tćdԈ8d`$ċԋ$$D@d\xdD8DTTtĔ,@Th|dĖ($L|0\x$DTԜ(DD`ԝddğ8$\ġD0\Tĩ 8$d$ 4\ij L 4x   Ժ4!d!x!ļ!Լ!!!! "t,"t\"p""D"$"T##0#D#TX#l###T####T# $ $4$TH$t$$$%<%h%%%&(&T&x&&$&D&d&'0'\'4'D't''''4(T0(\(p((((d()0)$\))D)d)t))**,*@*T*h*t**++$(+D<+tP+p++$+D+d+t+,,,,@,T,t,D,d,,,,-4<-dX-t--$-t---$.T,.d@.p..$.4..4/t$/H/\/T/V/zR|   F J tx?;*2$"@$T 3C elH7C sp#7C s(-$VAb E ] C I$DC n G K T#4pDC n G KT(hA|QD7C sl6C U H U^C c J c!C0] CPZ C I G $CAC {CDAAC yCd?AC wCt|_W4C0p<=C@yd=C@y CPj C Q G ,XpAC@Q AB PLAC v AE t4C ^ G K4C _ F K?C _ F V00C HHp E x H V B 0C HHu H y G \ D 0<XAC w CB S ID eADp5AA C M  CAB S  IAC  AA4AC G CB S ID eAD0AA C M  CAB S  IAC  AA48AC G CB S ID eA$pdC HHPY D (LCPHHHHV G 0@#C HHw F _ A L L 8<>AA C u  CAB   AAK (4@C v G K E H x G(`C z K H p G I O C w F ` h O(t C r K H P G I K8!AA C E  AAD K  AAK !/,,!AA C _  CAH ,\"AA C _  CAH ,X#AA C _  CAH ,#AA C _  CAH ,$AA C _  CAH ,X%AA C _  CAH ,L&AA C _  CAH ,|&AA C _  CAH ,h'AA C _  CAH ,(AA C _  CAH  (E (M84 0)yAC e AF  AD  AF 4p t*AC C CF S OF K QD $ *C HHH| A ( -EAA C b  CAE ( -C@HHQ E P( /H AA AAC@- AA AAH CAA AA(| 8CHFNFX C T 8fAC AAC, CA AAB } CA AAE < 9AG FAC\ AA AAB (@ t<CEMN H <l =5AF AAC0 CA AAG < >AA CGK@ AA AAE < >xAF AACP AA AAD <, ?AA CGK@ AA AAE <l @AA CGK@ AA AAE < AAA CGK@ AA AAE < AAA CGK@ AA AAE 4, HBAC AK o A AAA <d BAA ACK@ AA AAE T CAAA ACKPz AA AAA  AA AAB T xENAA ACQP AA AAG  AA AAF DTpGAA CK \ A AAA o A AAA <GAA CAKp AA AAA <xJ_AA ACI`+ AA AAB MBEe N A@M2C nXMHC D,p$NCdG B ] K N!,OyCdq H c E 4PPAF I C E K E E K EHP|C H_d B | L Q G  E ] K <hQ*AA CGK@  AA AAA <R(AA CGK@ AA AAA <S(AA CGK@ AA AAA ,(TC Rb A { A XC l C $@>C l C @dVC s H \\C ~ C xJC n A  JC n A TJC n A ~C0V A ZC r A 0ZC r A 8 tAA C0g  AAB W  AAA \،6C f A x,C \ A =C m A 4,C \ A H,C \ A \ht+AA ACC4E AA AAF " AA AAB g AA AAE  AA AAE m AA AAG 9AC sA(CAC }AXdCAA?00đxAA AC nA AA dgAC P FA \1C \ F ,iAA C B  HAA pAC R AA 8 }AA C I  AAH J  AAA ,4 PAC i AB C CA $d MC@e~ B , tAA C [  FAA , hvAA C ]  FAA 4 uAA AC Z F AAA 4$!uAA AC Z F AAA ,\!HvAA C ]  FAA 4!uAA AC Z F AAA (!LC@SR D l!AA AC@ A AAE N A AAG  A AAB  A AAF H`"$/AA AC@n A AAA  A AAA ("C0TR A ("C0TR A <#P!AA AAC@, CA AAG D#@9 X#l>AC S AA |#xAB K#hC T#p<#lAA AAC@p AA AAA 8$̞dAA AAC@XAA AA8D$~AA AAC@rAA AA$$DcCPYS A $@AE vC$$CC o A $C W%$%=AC pHD% /C W I `%4.C Y F |%H.C Y F %\ C W%d!ACYC%t!ACYC %]C O~ A &]C O~ A 8& C WP&JC i F l&8>C n A (&\gAA C ~  FAF <&AA AAC$^ FA AAB (& aC`KR E 4 'dAA AC o A AAH (X'ܵQC`LFN E ,'|AC B AA \ IC h'`AA AAC@ AA AAB  AA AAG wAA AA (C Y L c@(D+C g0X(\fAA AC XA AA(9AC hC(%C ]$(C HW C <(AA AAC0V AA AAG ,)#AC]AL)ACTA<l)3AA AAC AA AAA )))C O)C 4*QAA AC  C AAB ,8*,TAA C   AAG h*\jC OK A *7C [ M P*AC AAC@ AA AAG mAA AA*<+AA AAC@ AA AAG P+4 AC VAp+4 C \+< AC VA+C n A 5dC H A 5dC H A 5PdC H A 6XC s F 6XC s F 86,zC I F T6uC D F p6ZC u F (68CoUI{ E 6 ZC r A ,6PAA C   AAB 7@C V F  7C S R <7XC d F X7RC o H t7JC d K 7DJC d K 7xJC d K 70C V K 7C M H Q H 8,>C0n A $8PC X<8XC O T8`OC Ow A x8C d A 8YAC L CA 8<C d A 8C O08}C e H S E O A O A O A  9C S B <9xP9td9px9l9h9d9`9\SC r F 9C b A :\C { A :XwAC R CA @:CT:C  A p:dCQ A ,:hAA C v  FAA :AC d FA :DAC e FA ;C ;|.C b A 4;WCSL;C  A h;\C  A ;C  A ;dC  A ;C  A ;wC g A ;@}C m A <hC A D E A 4<^C @ A P<4`C B A l<xJC m H E A <>C n A <<C l A <AC0 AA <AC0 AA =HAC@ AA 0=$AC | AA T=C u A p=C u A =C u A =AC0 AA =AC0 AA =TC u A  >C  A (>C0 A D>` C  A `> t> OC  A >4 HC g F K A >d HC g F K A > C g F > HC g F K A  ?H =C m A (?l EC u A D? EC u A `? EC u A |? 5C e A ?, WC v A ?p ;C k A ? C0r A ? DC0t A @< AC0n AA $,@ lC MFf D k$T@ xC MMl G |@H@D@@,AC cD@P,AC cD@`,AC cDAp,AC cD$A$AC [DDA,AC cDdA,AC cDAA9AC pDA A A A 8BAA AACPAA AADB0ZC HGG<dBpAC AAE0 AA AAA B QCr C (BdVC@MLOj C BuCC (C  <AC xA0t$>AC xAPt$dC H`xptD%dC H`x(t%C0HPd A 0t%sAA AE eC AA tD&HAC BAup&(u|&6C \ K Du&<C [ R `u&uAC ^ FA u 'tAC ] FA u|'NAC w AF u'NAC w AF u'iC OJ A v (iC OJ A 48vl(AA AC i F AAA 4pv(AA AC i F AAA hv<)AA AAC@ AA AAH P FA AAG C CA AAA hw`*}AA AAC@ AA AAH Q CA AAA C FA AAA Twt+AA AAC@  AF AAC X AA AAA Tw,qAA AAC@ AA AAG E HA AAA T0x-AA AAC@ AA FAH G AA AFA Tx /{AA AAC@ AA AAD G HA AAA Tx40AA AAC@ HA AAF G AA AFA ,8yl1"AA C0J  AAG Hhyl2AAA C [  AAF X  CAD C  FAA <yp3AA AAC0 FA AAA 8y4AA C T  AAE C  CAA T0z5}AA AAC0 AA AAG Y DA AAA z6'C0cDz6AA AC0 A AAH C H AAA Dz7AA AC0 A AAF E H AAA T0{48AA AAC@ CA AAG C CC AAA T{8AA AAC@ CA AAG C CC AAA T{9AA AAC@t AA AAA E CF AAA T8|\9AA AAC@v AA AAG E CF AAA <|9TAA AAC`% FA AAA <|:BAA AACP% FA AAA <};AA AAC@ FA AAA ,P}<AA C   FAD }T>iC T F <}>*AA AAC@ AA AAA T}?AA AACP AA FAA \ AA FAA T4~0AAA AACPZ AA FAF _ AA FAA T~B"AA AAC@ CA AAC X AA FAA T~pCRAA AAC@ AA AAH K CA AAA T<xDRAA AAC@  AA AAE C CA AAA <E4AA AAC` AA AAH <ICAA AAC` AA AAH @O AA AAF AA AAG X[C l[C [CM[CM\0C ` A (̀\KAE Y AH ZH<\$C `T\(AC ]F(0d\AA C  CA\(]C Pt0]C Z8]C Y@]C YH]2AC gF܁h]*AC _Fx]*AC dA],C \ A 8]AHP AA \(_C0T A (x_AA E d  AAA ,PaAE Z AA w AE Ԃa"AE aaCaC,bH@b5C T@bHhLb}C0|bC 4cC 0c7AH Tc!C ԃpc*c c4AC nAc^C j C 8c^C j C $T0dC MHH@ H (|dAA C  CA<\eAA AACPAA AA1C ((lC0OKH B ( m#C _(@$m#AA C  CAl(nOC d A fLAE C S B a@TAA AAF8 AA AAG +FNK{++gF`4+gF`P4,gF`Tl,AA AAF AA AAB e AA AAG 4.AA AE@ A AAH 4x/AA AC@ A AAG 4400AC O AD k AD kAl0)C ^ A 0 00$C V G ,0AA F  AAA (X1FAA E z CA((|1VAA E J CAT1 h1 @|1)AA AAF AA AAA 2`AC ZA,2AA CP  AAC 3=AC wAP43AA AAC@ AA AAC CFA AAL4\C a A 4(C d,4AA C r  AAG (5BAA C z AA(,5ZAA C R AAD`5X\5lX5T5P5 L5 H5T5 P5SAC MA 5QAC KA,5cAa,H6lAA C`_  AAA ,x\6lAA C`_  AAA ,6AA C`  AAC ,,7AA C`  AAC 7-AC gA(7C E D9X|;(lx;BAA C z AA(;ZAA C R AA,;kAA C`^  AAA ,<AA C`  AAC 4$<AA AC` A AAB ,\=nAA C`a  AAA 4X=AA AC` A AAA , >AA C`  AAC >=AC wA?=AC wA40?5AC oATP?hL?(|H?AC g CJ aF(?JAA C B AA?EAC A@EAC A@@EAC A4p@EAC AT@EAC At@EAC AA @AH x AF AVC L A EACRA!C ( BC MHe K ` H DBXBlBBBB3CC CgC HHFM lCgC HHFM ,CiC HHFOPDC <dDAC AAH@l CA AAH (DC0FLv E S E $EAA CAEP$|KAA AAE` 4M8C4`MHQ\QCpQC0R3C o$RjAA AACPUU)C eV(C0d$,V_AHO AA $0dVC@{A A XWlWWCVWCVWW(WAC  AA LAXXC W80XAF C0  FAG W  FAB lYC W YSAC MA4,ZKAA C0v  CAA H AA,DZDAA Cp)  AAH <d[3AA AAC@%CA AA(Pd\AC w FG KC,|dAA C@m  CAB He)C` A \eheteWC E C  eJC p E E A ,e@C i H H fHC x A (d@f5F Kp A TgAE0 CH @hC  A 0hAA AC {A AA,@iAA C   FAD $4jC TV A ,\HkAA C g  FAA kC YkC W.3AE . C kmC g8 lAA C0~  AAC q  DAB @lZAQ F Ad mx,m+Hm{C _X mwAC oCn?C e K (n:C e F Ln?C e K $pn:C e F @n<C l A \n<C l A xn<C l A o<C l A $o<C l A Ho<C l A ,lovAA C V  AAA o;C k A ,4ozAA C d  CAA d0pEC u A dpxAC f AA (pC0JO A dqJAC s FA qJAC s FA qKAC t FA <qKAC t FA `rJAC s FA @rJAC s FA lrJAC s FA rJAC s FA rIAC0w AA rIAC w AA 8sCAC l FA \HsoAC X FA $sC JK] A $sC JK A (tC0JO A 8uC OuC Y4u HuLAC FAlu CU A uCT A vLC q L 4v0C S B SDv C  A 8wcAC v AA  wC  8LxZAC j CB \x^AC q AA x<C [ A 4xAC  AF z AE A z^AC l FA zFC  8{C 4{^AC q AA ,Dp{NAA C   AAF t|C ||||HC r K ,|!C0MLB B  H }$}8} L}C \T E pT~AC T CE ,~eAA C E  AAA <xAC l AG Y CD C DA TC<PxAC l AG Y CD C DA TC0DhAC q AB T AC TA(x̀AC C |  CAA C O A | /Cf A ,FC v A H́ \ȁpԁ1Ao8AvGC ^eL?A}pNC ^lMC _j$ЂFAD@UC ^s`DTC _q [Cct aAC[AT #AC ACE0 AA AAB ` CA AAA T AA CAC` AA AAC  AA AAE (x C@PK F TOAA AACp! AA AAD R AA AAB (1CPLPHQt D (("CPHLHQt D (T"CPHLHQt D ("CPHLHQt D ,AA C   AAE $hCPug A (`C0JMe A N B 40AA C0n  FAF c AA8h|AF AC  AAC l IA4БAA Cw  AAB a AAhHAA ACE@ FA AAH I FA AAF FA AAHHAC E0a  FAG d  AAB _  FAB (CAC j AA QA$C0HLHe D PLAA AAC`6 CA AAA sAA EA<<AC AAH@ AA AAF ,|AA C   AAE (40, ( $,$0C MHJ E _ E T`C PH,t@C MHJ B _ E '<,0C@MOZJG F K E Kb, xAA C@  AAH <(+PD1dp1x1Ƞ11 1L1x11С11,(1@T1T1h1|آ1(NC`S` E (( CPHPQ A T AC H AC s AL m AB  AB t AC X AG @OC K(XܦC@d B v('CPOY B 4AA C@  AAE j AA4<AA C@  AAE j AA4 ԩAA C@  AAE j AAXlCC (p:C@JL^ E ~AC a AA aAC D AA ` l x( <AA C0o FA(L7AA C0m CA(x/AA C0e CA$ CPHR{ H  &100:AA AC0lE AAd(x@AA C0x AA0 ,8D$C [(\EAA C y AA0$aC LX{ F X H ` A XAi F (x\AA C0 AA(]FN\T F (CPHHHHc B $8CL`Ct|xPtAA AAC@ AA AAF AA AA,^AA GK  AAA H\ p'=AC wA <<C HHI_X!AC [Aht$8|Lx `tt|x0C HH\6C HHbAC UA%AC _A0D5Cq$\ض;AC H AC ,C \ A 1C \ F (C P0VC z A tPC0W F  (C0 A (KC o A D+C g\+C gt ,kAA C W  AAA \X1C a A |C,xrAC G AD H AA ,|C OE A P$<C e H lHXAC z AA C 8aAA AAN0JAA AAXo  o/  P@ooo fv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfvl w    » ۻ  (   . 8 E U c     H Ѽ ȼ    1 N g    Խ   # = Y v    վ  l     ' A U p     ÿ H ڿ  p  & 7 L f  }       (  T x  / 4 A N e n           ' ; N ` o    p          : J b |        $ 1 C V j         ) ? U k         1 > X j y    1    U           -  4  G S d  k r 6 x          N    A      " (  2 $ B L  W c o t ~       n      $ 4 F Y l ~        ( 3 @ [ /     0 X r    ^     .w_()'"$\/<>             7 F U g y  D           ( 8 D  N T 2 \ h r y     & B          w       ( / 5 < F N Y b j v  5 O U                 % 4 J \ h |          % 9  G a r          ( 8 I a s             >P> d d d d _ ` h p> > > ? ? @? 0A @ p@  @ _ ^ a h V pG `^ P^ @^ 0^  ^ H j J `L 0K @h h g g @g g f @f f e e d A @e e f  k ^ c @c                                       D  0 h T  @   8   y (     d   | y  z    @ x   X  T     8z  $ \   $ $ Mz      (      $ L  t \   l  X 4 `  H t  \  8   \   D  , @! ! ! D" " " $# l# $ ( ) ) 4* , T.  / @/ / / 0 0 (1 1 1 1  2 2 3 3 x4 5 6 $7 7 X8 8 |9 X: : (; < = = l> >  ? B HD ,E kz H I \I I J  K hK L L L DM M N `O O  P \P P ,R tR R R 0S lS S S  T pT T T ,U lU U V xV V V (W \W X X Y XZ Z L[ [ [ |z  \ \ z $] ] ,^ p^ ^ 0_ |_ z _ z ` z ` \a b c c ,d d e { @e de f Hf f g Tg g  h h i Di hi i i i @j tj j j j 8k |k k k l |l l m Dm tm m n n ,o s s s xt t (v tv v w @w tw { { .{ :{ G{ P{ S{ V{ Y{ \{ _{ b{ e{ f{ i{ {    { { { { { { { { { | | ,| 9| I| Z| k| {| | | 9 | | | | } } $} 5} G} X} j} y} } } } } } w } } } ~ ~ ~ ,~  3~ :~ C~ P~ \~ k~ {~ ~ ~ ~ ~ ~ ~ ~ ~ ~    + 7 E R ] i x        w   w x $x Dx  Q   $ 5 ϸ G Z r     € Ԁ      $ . <  H _ q    ف     . : F R n    Ȃ     e ( < J X j z     y  ǃ ׃ ܃     1 b K L d t }     ̄ ڄ   x 0 L e    6   - > P [ i z     … ΅ م       dx   x x ( A V p    ņ Ԇ ߆      * @ K ^ l z      χ ߇     " 0 A R c p      ƈ ݈      & : E U f    ĉ Չ ՞    ! 5 K c {      Ɋ ڊ      ( 6 R x o } j     ɋ ߋ    0 D Y n  <  Y   ό K       - > P c v )  և w '{      ֍     / = J c S r     Ď Ύ ݎ  ߟ   - 2 E \ i     P|  ͏    x , H a ~    y @ ސ H  k   o     s  a| / H ] v    ‘ ۑ   % > U  j a    @y ǒ ؒ   & 5 D O a |     Ó ד     0 = Q c w     Ք   r|   # 6 F Y s   ŕ Е     , = L U \ m  |   ǖ   $   - H b w    — ԗ  H  ٛ   % : K [ k    ʘ ݘ   dy % ; K ` r  |     }} }  ș י y y    8 S } h z     ǚ ݚ     / A X o     ͛     / B U d u    œ ՜    & > T i     ϝ     9 O f  {     ў     )   C Q ] m z   ȟ ܟ     4 y Q _ y    \ n z    Π     5 J } W `@I0G`H`JDCFBpA  Ё O`@`! ! ~}@0~0P}}`~}@-  PЎЌPЍP0PpЏ     - 0 - `, % ! $ @$ $ % @# # " " # ! @! @" " ! + `& 0) ( ' @( ) ) ' @* * & ' ( P' pQ) PP# $#p$ж@   <  :   P   p  П0 0[   Ќ  0& - P1 1 01 1 1 P P  ` [Pp    P\`Wp 8 9 p: :    ; `@  7 P8 07 @p    ` ; 0   p @l``PpPp0    0`Ё`Pp@ ""0!P"`0!`" @ !PXp2 `p002 a0* ( ) Z@( p( p`0 0 `%  * ( * 2 ccd А `3   @ @ @` `@``  @ . @ 3  `Pp  pP`0M `@ @    @ , * + @. 0@p0 % = @@?Pl pl0`&@ ``#Pn   p @    0  P p  P   @ p P     P &p@K@ JJP[Kf` VPе1 0p1 p` LP \0 p] 4 3 p P@Ц X P`7 p9 b0PZPss ` , 0  l`rpmmrsPttrxpv~@{0}0u zw1 p`ddd e`ee @ `@        $ # p# " P% $ %  0 ! `$  #   @"  P   P @  `& & ' & % & & p' &  & @& 0    ` = Pt`up`` `__^0S@0p0>@ GCC: (Ubuntu/Linaro 4.6.3-1ubuntu5) 4.6.3.symtab.strtab.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.commentTT#hh 1$Do3N 5PzV/Я^o;JkoKz L@ PPL   R.PPR ^   L  l l!5( (W ^ _  _ _ _ _ cL ? $= 0*ʯx  hP Th/ P  P   l (        ?   ( 5 K? Z? h` t ,  Г  @ 0  (  (c < M ]` wa { p P  a    %+ 9 PY~ uF F F F F F 1 P LL 4 (?` (JH Ya # u #   * 0   E $M  M  B  %L 5@M  A`M Zd3 w   m P  { { { ? @ !+? 5<E bf v   5   !x @#  $ >$ c% & 0' P(A *N , - "0_ K3B ip9* :( ;( |& p  + %-@a E \`Q hqy @ @  @ P  p  A X% tA ( `/ 8 ! K 1 V @ c $@ o Q ,@  `A hA   ` % 0   pA  @  & P' 7 lA B  Z (@ e P v  0@  @@ (  & W lB    0 @v (   B X% A    $ : { O  g dB u hB  Po \B  XB  ! `B  pB  B ( C  C ( `o  o ) A A D R D b @$ v   D  D     ) 4E  @E  F  E $ $E 4 F J F U 0E b (E w 8E  F RF bF k pr|F 0 *  ~ F  1F E W`irz0l5 n Po  G   G  @G  *G 8H Gp c  v" @! p* H  < 4P Z 0 5<  I VH l% ~H $H  D '3 F @I0<  [`H qzF  I HK LK I  I HI HI H+@J H=J HPK HdPK sSK `K K K K K @]  b M K .K Cb  T[s  et [ z`t q   L a #  H @ ] L L   T ! L + L ?H  ZdM gptM xM |M M  q +@ `   M "  5  A  YM i  | 8 Q Q Q M Q    Q  ) 4Q ?Q J0 ( i Z }Z ` _   Q R Q Q  Z %  9 b E@b @Qb <dr  A  @  @    %  a  %  G  6i  M  d  {      0  9  O  'I  FQ  ra  g  n        &  =  U  p  <  J  l  z      (  A  [2  pE  f  o            )  B   [A  rq    8  -  5  :  E  M  *J  NY  ) r s aP  np  yb b j   {  { { {   @>   ) { < B # E 0C  R E  b PS  y 0U  @ @ ${  ({  ,{  0{    4{  !“  ! $! 5! B! K! ^! t!U ! h !F !0b O !? !O 5 !  !K "%  &" A"W"? h"@/c "  ""O "0 V "  " # g '# A#X#0m o#  ##`9 ##{ #p* #1 $)Q &$`&  <$  N$ q  m$`1 $j # $  $0_ L $? $Pv $  $} %% %  +%P  B% ] Z%"5 p%0m z% l%d %` %F %@- L %P" %P\ % &@  & -  =&) 8 P& ] l&@{ t&  &P[ &&&p` A &4 ^ &&{ ', %'p  ?' T Z' 3 p'0 a 'Psu ' | '$ 'p%x '0  '} ( (  ;(N M() e( y(} (  (_" ((B  (  ( 5 )5 )$ E /)k: :)@ M)s  a)` + |)=y ) T )P )| )@' ) p *@S "*z  3*3 ^ E*N  U*PR f* z }* *p6  *К 3 *   *`5 < *++%+" < 4+{q G+ b+  +/ +pK  +d +# +  + e ,#,  8,  N,P ) i,+ ,3 ,| ,F ,@&, ,,2 - 3 - (- E ?-0. H-p=  S- n-H -S  -F - - - - Q - .0# #. <. B R.  ]. }  x. .{ .  .  .P .? . /( J /N  4/1+ A/ k ]/@ m/ C /|| / < // q /0~\ /  /  0 m )0 M00/   m0  00 = 01  0@!A 09 0 1Ѝu 1 .1F1 ) a1| w11@h 1 1^ 1А  1i  1%  1 | 209 2| .2=2C2% x [2? m2`d 2@  2pv 202 @ 2x  22"E 3;  $39 83G a T3, e3| u3Ue 3 330J 30>  3G 3`W  3@W 4T !4  04  H4@kr V4 g4@@  ~4k 2 4`v 4p4 4%  4X 41 4p  5Ѝ  5  )5UI <5` < Y5 = r5j - 55@O  5# v 51  50 55x E 6+ "6J f A60~   _6: r68  60 H 6Z 6  6 6 $D 6< # 7 )7 = >7N7 + < j71 ~7J 73 77Н [ 7 P * 7F  8` ) *8# >8 = X8 h8@ g ~8 8/  8Z 8} 8 c h 80 8{  9@? 9`0 C 69PV C O9 `9r9s 9  9_ L 9X 9_  9  9  :@  /:`B  >:pw  U:g i:~: : h : : { :p J :x| :  ;  ;  #;`{ $3;| D;c$ T;P  g;) {;` ;x   ;П> ;  ;P  ;@ 0 ;  < <`7 9<  P< 4 F a<1  u<p S <Ё= <0x  <Pi <Ip <@, < c <042 == ={ 3==  K=@  [=P$ y=? =pI =@ ='  =@( J = 3 =# => > +>;> U> Q s> >tN >k 2 >~J >X  >>\ ? @ F ?0K " 6?h& B? U?, a? T ?* * ?p~ ?I ??Џ  ?   @!= ,@@e 1 =@E Z@` x@  @G @a @T  @pU @@Pf  @4 A& J A% >Ap3 TA eA[ }AC AA! : A A{ AA@\  BB  7B@> LB_ `B&, oBT B H Bp B t B  Bx  BP>  C= F Cw /C7 k CCd 1 PCO  nCC Cz  CCP' K Cp4H C ^ C  C"W DpO   )Dst HD@w  ]D} zDW D06  Df 1 D  D 0 D= / DPd D` DPX8 ER  !E 8EW MEm bE 3 yEE  Ep1) E  E@3 E  E0 FJ FR ,Fp < @F M  _F0 Fе F0Q F F  FFF1  G  GP  5G ) NG Q aG5 G G? G@F GP ) GG~{ GpXN H! +H0 ;H 9 LH`  ^H8 U qHH} HY  HH X HO  Hu 7 IpQ I0 _ /I9 CI |PIJ hI{IRi I+ Ii  I2* II" I0 I0#A J  #JP9 4Jp4  ?Jt OJz `J/ $ zJ JD+ J_ ` J JJJ0 K`v  K Q /K0 IK`KPn' qKZ KKPr KK`$ E KPtN K!& K L  !L=  /L V FL  TL iL* * LT Lp ^ LO L0 L` L Z L  LM Mm O .M ` BM`@ ^M2 e lMp M M` ( MD M  M MT N & N  /N DN0OM TN"  jNP}> N0A [ NN` Npn* N@4 N< O`H -OG =O@  VO' J eOxOOB 3 O  O  O s O  O02 P` ; P,P  HP} ZP  ` kP1 < wP10 P@ ? PP= PP PМ 3 P J Pp 1 Pu Q0 'Q] 7Q=Qr6 PQ`,  ^Q@$ z uQ+ Q  QZ Qpf Q > Q  Q % R4 R{ $R :RЌ 1 XRP1  iR}R(  R0 R0  R  R 3 RR|  S1  S| (S` =SC MS `S| ~SP S Y  Su   S| S Sp Sp S! ? TЛ 3 T&T( I 6Tx a STz : nTP=  T`J T0 T W T@K T| T  T@T  U  U0U  DU, UUnU  U_ L U| UU( n U@ P U b U V r (V`< WGWp* ZW0-  eW^ |W  W? M WWW  Wp<  Wx XXp 6X l MXv   bXqs XK X2 Xp1  X J XX| Xh 1 X  Y Y , n /Yp E DYP WY  gY3 xY`eA YY0G# YA a Y YJ4 Y0p Y E ZE Z4 2Z{ JZ7 ]Z nZ 9 Z? Z@z  Z l 2 Z4 ZpG Z( ZZ0 - [A  [c  -[@# < >[ ^  ][p&, n[A ! |[ [ O  [X [) ` [` [[@L [@! : \  +\p @\| N\{  f\   \\ \T \0O  \ \I \" \ ] ]  2]d I]pY Z `]r] K ]!  ]`& J ]Z  ]z  ]@  ]0  ^  ^2  )^p ;^0 N^`Q  f^v  z^] 6 ^@= ^d9 ^  ^^P^ ^  __g 1 '_0 k ?_@A P_ < d_w @ w__Z _ _W _&  _ n - ` z ` .`  I` ]` o`  ``  ``,  `-  `Pn I `0^  a a t #a 2a`> Iap6 ^ad oa a=   a02' a D a  a  a n a^  a < b|  *b@h 1  vb0A b`U  b{ ] b B b0 b L b< b| c V$ &c V  5c  Jcq  hc |ccc@T c@r : c  c| c doe "d' K 2d  Pd` ld@V' dd. d`' ddW dd| d dy eh N *e  ?ep  Se`3 e e  e0  e  e e@/   eP 3 fZ  f ,f L ?fv i Pf| ifF+ vf@ f D fJ  f ( f0  f# f i g# < g7 #g`  je 1 k5 k %k@ M @k; F Vkp1 < bk < nkk? N k  kPnO kR  kp2 w kP`V l l k  ,l5I 9l | Pl ` _l$| nl ls< l7 lU  l&, l  lt  m`L " +m;m@ \ Wm@.  }m  m@_ m7 U m(| mmP  mnn  *n}6 =n` A Onh  fn{ qnp# E n n0 D n1 n` n`} npA nG o   $o5o! a MoP/ S ho`w : o`l x o  o oP o} oТ  oPq pPA p  :p& Hp@v  ^p`rH sp$ pn ppa M pl5 p< p9 e p pti q0g  qPu / ;q`H  EqWq  jq  q  q@W  q q qM q w  q  r , !rP7 5r6 H ErZrg ur{ rr&, rR  r0 # r rG  rj   s s0  =s= Ls  \s |ss0 g s@c b sp' s  s`  t t E *t@ T DtVt p stt,| tT t p t  tB  tp: I uP 3 upu ( 'u /up Au| Yuku  yu  u@  u  u 9 uuu' J u"G v  v2vCv/  Tv S gvt  zv@ vv vXM v0| v@@ vpZ Z vЁ" w@ #wf Bwi [wxw/ w 8  wP#; w < w 3 w 3 w$ ; x!x2x0= >xT ( Nx(  dx' Z x0` x`X x. xl x  x. yPA & y/ ;y] Ly Xyp, cy7| syC y| y y  y0S* y = z`  z . 0 2z4| @zU } Nzez` lsz G z`G z`@ z zP~  z& ( z$ E {( *{p C{  _{  r{  {  { y { 3 {`v {d {8| |O |)|@; 6|- K|r ) ^|` p|( | + |PJ |H 1 |x  |F |w  }`' }0A  3}| N}6 ! Z}  t}P a }"8 }  }h }  }!E }}P 3 ~`  ~ K "~` S =~8 P~h a~P ~~ ~~ ? ~ ~  ~  '  { +` < Tp> 1 nJ ~@m @*  P4 m _3 J #@" < 2H / a0} wP*V @ , ɀۀ`+   p| / $ 3E`$ Su oo> ` Pp  ʁPD l { & )p\ M<| [G qp   5 `> { ҂f 1 !.  ! 3 '`6  1@\ - Up   j}V ~@< | ̓PP &    ^ 1A, [~ nO \ &  Y ń08  Ԅ F  @ H "< :R ` f m}h|   @ &  4 N ˅  ޅ`O    P  / >@  M  Z2 n      ` 9 ̆P  А k b : F /u  @1 WJ " k@ z@y  P  < h 0!H *  ȇ 0# V  T "T ;v & Q am 5 sP \ : I Y ˈa d   {    8[ Pe 1 aPP |`  @ V ( ω    @ 0Oe BP 1 c~J s S \ P `ed Ċw يG   ' 3P= B@? ? \-   h  x i L y : P  ʋ {  t < ,`$ >? Yd og 1 } ! P V t  ČPb/ ό4 ܌@&  t a `m  $6P6  ?t  _p 00 ?   ЏL ۍ ) d  6  S&4 c|    ?  < Վp'  8  P Z < %) o <`}  P) C b  i  |@ <  b 0   Ϗ@ @ 0p>     " H ;P h PF ^  x b  x l  A Ԑ9 U   { ? `2S +. 8 3 FpLz Wh1 { # `  `  ّK$ H   ( ;@# Gp4 [  p`T   h  # @ ̒| ݒЄ ( P   "J 5Z" J. = h } w ^  ғx   "0 =| QC a07 N ql M 0 < &$ ` Δl| @| D| U  ,  9  FPx $ T` Z j ` L ~  ` ' ϕO p@ U &  0 ;| I$ E c@-` s( xH| @1 pml % ˖'   < |   04 G X" L v.  m p! @ ) Η0c, O  p9  p  (Z {E 7L| Bd  Y# L r  }pA H T `  Ә = =  4 ^  -p]' Hr V@, ap0 w} 5  + < 0', י0u ?  C P  &A  504 R  i{  p pq " < Śp Z ؚF @^   a 0 Ѓ  /Є % @ ^o  wp. ; x   ) Pn ' Л w }> p  / / C # XP"D fwbP < P| Pu ՜Pc 3   +` = <p M ^pC @ C T| Pz  ֝` ! 0 # @ . 8+ e Y2q f=[ y }  pe  M    ٞ04 &     ' -A02 [ ( n'k p7 { 0 ȟV ڟ0q   ] !+  1 F W iP = h a R ʠ%  ڠ x 3 - "I ; M, [. q5 )  0 ) ɡܡ@lK T f 1   -e 1 :@,  N  c9 sЌt d +  t ¢  ߢ, `k B @ )0, : ! Kp ] E    < ϣ-  ۣW  T   ` 2j K'o b%l k! ? {& \ LC m ٤cL '9 0 3 0/ )@\  E= S`^  m  @r rI g  8  ͥp ޥ T } (   4  C{ YE d@ pi      ˦_  P  `! # /pN  Cp[  [ n> 8 eA @f 1 | ` @ ԧ0} B 1 ^ s ~ )X <@"  T0, e@w  0  `P ̨?   x} `59 p ' : Q e e@ t`   | '6 ũ թC  p l 0 E 2Eж, `@-  |  h T N  Ϊ@   ? | p !  2p 6 B{ SR jF { _  #  @ ȫګ@ <  1 f "~  5  M g`d8 uq C P^   0) I ̬  ެ  B ^ d9 .pX Z Ep j Rl h`% w 5  Y ˭    `T 3 H T  h! P.      lr Ʈ7 ڮa   u 0T  D R8 e`6 {'  G pd 0[ ӯpG O j  c (  >@T W@1 pp  5! P% E ʰG װ? !P P 0Z -P S Hc `P = y`] Pu Ա', 0 6    0P< CXr4 plZ  # E Ʋ  ײ g m - L '? =` 4I l `4 p*  3 ijP5 г+u ޳01  ; x { @g 1 O * ,Q ?`# cpF tt| `=  P 3 P+ ɴx a ppd g ,@, GZ  bЎv y0 Z    ǵ(  Ou p  X| "5v 6 N0U dz` 2 , . % E Զ  ڶ" < `/ c ^ L P = !0 - 4 : F Q e j{| g ķg 1 Է\| k  $ E 0 5`R HF ^  t,  = v 1 g  θC  ݸ|   J 2   @`Z R < k0w 1  ^ . ˹`| ׹`"E p 8 %F =0  Sp d p> G # ɺc h  K X    -F R c vpt   h 1 p$ ƻ~ ٻ0* ` i ?  p=W ! %, ;  PkW |r W i  `7 ( `  ּ  crtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.6159dtor_idx.6161frame_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxlookup.cunbind_variable_1count_referencesupdate_assignment_referencesallocate_frame_extensioninstall_cache.part.5move_all_referencesdelete_ref_pairsguarantee_cacheupdate_cache_refs_space_1update_cache_refs_spacemove_ref_pairsupdate_clone.part.3update_cloneupdate_cache_referencesassign_variable_cacheassign_variable_endscan_frame.part.0find_binding_celladd_cache_referencelookup_variable.part.7option.csearch_path_for_file.part.1option_raw_bandoption_raw_constantoption_raw_heapoption_raw_libraryoption_summaryoption_raw_stackutils.cterminate_no_interrupt_handlersave_history.constprop.3error_death.constprop.0CSWTCH.113CSWTCH.115error_argumentuxsig.crestore_signal_masksave_signal_maskinvoke_soft_resetdefsignal.part.0examine_memorydescribe_sighndsignal_descriptors_lengthsignal_descriptorsstop_signal_default.part.11reset_choices.10233blocked_signalsbuffer.9814signal_descriptors_limitpruxffi.ccstack_lpop.part.0cstack_pop.part.1arg_address.constprop.2arg_pointer.constprop.6c_call_continuerun_callbackreturn_to_cboot.creload_saved_stringreload_saved_string_lengthartutl.cavltree.cbias.4951bkpt.cbignum.cbignum_digit_divide_subtractbignum_digit_dividebignum_divide_unsigned_normalizedbignum_trimbignum_positive_hamming_distancebignum_bitwise_ior_unsignedbignum_shift_right_unsignedbignum_bitwise_xor_unsignedbignum_bitwise_andc2_unsigned.part.0bignum_bitwise_andc1_unsigned.part.1bignum_bitwise_and_unsignedbignum_new_signbignum_multiply_unsigned_small_factorbignum_add_unsignedbignum_subtract_unsignedbignum_maybe_new_signbignum_divide_unsigned_medium_denominatorbignum_divide_unsigned_large_denominatorbignum_bitwise_andc1_unsignedbignum_bitwise_nand_unsignedbignum_bitwise_eqv_unsignedbignum_bitwise_nor_unsignedbigprm.clistify_bignum_consumerbitstr.cbtbs_consumerbstb_producercopy_bits.part.0char.cdaemon.cdebug.cdo_printing.constprop.5Back_Trace.constprop.7do_printingdfloat.cerror.cgeneralizations_union_2next_condition_type_indexcurrent_handler_recordcurrent_restart_recordextern.cfasdump.cfasdump_precheck_frominitialize_fasl_headerfasl_headerfhclose_fasl_filesave_tospace_writerun_fixupsfixups_startfixups_nexthandle_ephemerondumped_ephemeron_counthandle_environmentcurrent_env_modehandle_variablehandle_symbolhandle_broken_hearthandle_linkage_sectioncc_seen_phandle_manifest_closurehandle_primitivecurrent_prfasdump_transport_wordsfixups_endfasdump_cc_entryabort_fasdumpinitialized_p.6891table.6892fasl.cfasload.cnew_prim_tableintern_tupleintern_vectorintern_cc_entryinit_fasl_filefasload_raw_address_to_cc_entryfasload_raw_address_to_objectintern_handle_symbolrelocate_address.part.0new_stack_endnew_utilitiesfasload_tuplenew_constant_startnew_heap_startload_filenew_stack_startinitialized_p.6855table.6856initialized_p.6889table.6890fasload_vectorfasload_cc_entryfailed_heap_length.6784reload_band_namereload_cleanupsterminate_band_loadfixnum.cfloenv.cscheme_fenv_pscheme_fenvflonum.cdouble_to_flonum.part.0gcloop.cqueue_ephemerons_for_keynewspace_starttospace_startephemeron_queuep_fromspace_startp_fromspace_endscanning_ephemerons_pweak_chaintospace_nextgc_tospace_allocatornewspace_nextnewspace_endtospace_endgc_abort_handlercurrent_scancurrent_objecttospace_closedweak_referent_forwardephemeron_listinitialized_p.5761table.5762generic.chooks.cwith_new_interrupt_maskhunk.cintern.creplace_symbol_bucket_typefind_symbol_internalmake_symbol.part.0interp.cintprm.clist_to_integer_producerlist.clookprm.cmemmag.cabort_gcsave_tospace_copygc_if_needed_for_ephemeron.part.1allocate_tospacesaved_stack_sizesaved_constant_sizesaved_heap_sizesaved_toprimesmissing.cobstack.cosscheme.costty.cnext_interrupt_charoutf.cprim.cprimutl.cmake_table_entryfree_prim_renumbergrow_primitive_tablesprim_table_sizedeclare_primitive_internal.isra.0prim_procedure_treeprimitive_aliasesptrvec.cpurify.cpurutl.cregex.crgxprim.cstep.cinstall_trapsstorage.cstring.cht_resizeht_insertexternal_stringssyntax.csysprim.cterm.cedwin_auto_saveposition.6550new_state.6551delete_temp_filesposition.6567new_state.6568attempt_termination_backouttermination_prefixtermination_suffix.isra.2transact.cerrorexecute_actioncurrent_transactionutabmd.cCSWTCH.11identity_namesvector.clist_to_vectorsubvector_to_list.part.0allocate_marked_vector.part.1wind.cundo_bindingsave_bindingsave_binding_locationerror.constprop.0dstackcurrent_winding_recordprosenv.cprosfile.cprosfs.cprosio.cchannel_type_namesprosproc.cprospty.cprosterm.cprostty.cpruxsock.cintext.cpruxenv.cpruxfs.cfile_attributes_internalpruxio.cstring_vector_argux.cmemoized_clk_tckuxctty.cctty_update_interrupt_chars.part.0ctty_fildescurrent_interrupt_charscurrent_interrupt_enablespermit_ctty_controloutside_ctty_stateoutside_stdin_stateoutside_stdout_stateinside_ctty_stateinside_stdin_stateinside_stdout_stateint_chars.8541int_handlers.8558uxenv.czero_tx.9687initial_process_clockinitial_rtccurrent_dir_pathcurrent_dir_path_sizeuxfile.cmake_load_channeluxfs.cclose_all_directoriesdirectory_pointersn_directory_pointersprotect_fd_closeuxio.csafe_pollUX_channel_close_allchannel_close_on_abort_1uxproc.csubprocess_deathprocess_tickprocess_allocate_abortstop_signal_handlerscheme_ctty_fdforeground_child_processget_terminal_back_1sync_tickgrabbed_signal_maskuxsock.cdo_connect.part.0address.9887uxterm.cterminal_table_sizeterminal_tableslave_name.10070uxtop.cinteractiveCSWTCH.30CSWTCH.28syscall_names_tablesyserr_names_tableuxtrap.ctrap_immediate_terminationtrap_statefind_block_addressclassify_pcsetup_trap_frame.isra.1ux_signal_codescontinue_from_traptrap_recoversaved_scpsaved_infosaved_signouser_trap_statesaved_trap_statetrap_query_choices.10036uxtty.ctputs_write_chartputs_output_scanUX_synchronize_tty_size_with_termcaptty_x_sizetty_y_sizeUX_initialize_tty_with_termcaptgetstr_buffer.9898tty_command_clearUX_tty_with_termcap.part.0UX_synchronize_tty_size.part.1tty_size_synchronized_ptputs_outputinput_channeloutput_channeltty_command_beepuxutil.crestore_input_statebuffer.9599buffer.9611original_tty_statecmpaux-i386.si386_initialize_no_fpno_cpuid_instrdone_setting_up_cpuidnot_amd_cpuscheme_to_interface_proceedinterface_to_scheme_proceedinterface_to_C_proceedasm_sc_apply_generic_1asm_sc_apply_generic_2asm_sc_apply_generic_3asm_sc_apply_generic_4asm_sc_apply_generic_5asm_sc_apply_generic_6asm_sc_apply_generic_7asm_sc_apply_generic_8set_interrupt_enables_determine_memtopset_interrupt_enables_memtop_1set_interrupt_enables_set_memtopset_interrupt_enables_memtop_2set_interrupt_enables_determine_stack_guardset_interrupt_enables_stack_guard_1set_interrupt_enables_set_stack_guardasm_generic_flonum_resultasm_generic_fixnum_resultasm_generic_return_sharp_tasm_generic_return_sharp_fasm_generic_divide_fixasm_generic_divide_failasm_generic_divide_flo_floasm_generic_divide_by_zeroasm_generic_decrement_fixasm_generic_decrement_failasm_generic_increment_fixasm_generic_increment_failasm_generic_negative_fixasm_generic_negative_failasm_generic_positive_fixasm_generic_positive_failasm_generic_zero_fixasm_generic_zero_failasm_generic_add_failasm_generic_add_fixasm_generic_add_floasm_generic_subtract_failasm_generic_subtract_fixasm_generic_subtract_floasm_generic_multiply_failasm_generic_multiply_fixasm_generic_multiply_floasm_generic_equal_failasm_generic_greater_failasm_generic_less_failasm_fixnum_shift_negativeasm_fixnum_lshasm_fixnum_lsh_overflowasm_fixnum_rshasm_fixnum_rsh_overflowasm_fixnum_rsh_overflow_negativeasm_fixnum_rsh_overflow_nonnegativeterminfo.ctterm.cprotect_freeprotect_tctgetstr_buffertgetstr_pointertermcap_bufferpruxdld.cdld_unload_allloaded_handles_sizeloaded_handlesn_loaded_handlescleanup_registered_pcmpint.cabort_linking_cc_blocklinking_cc_block_popen_gaplink_sectionmake_trampolinesetup_lexpr_invocationsetup_compiled_invocationtrampoline_arity_tablen_builtinss_builtinsbuiltinsbuiltin_namescmpintmd.ccomutl.cilof_prefixusrdef.c__i686.get_pc_thunk.bx__DTOR_END____init_array_end__dso_handle_DYNAMIC__init_array_start_GLOBAL_OFFSET_TABLE_renumber_primitivePrim_process_tableoption_library_pathOS_file_truncateinteger_positive_pOS_ctty_set_int_charserror_system_callPrim_heap_available_pPrim_os_job_control_pPrim_find_next_char_in_setsetsockopt@@GLIBC_2.0tree_error_noisegc_handle_linkage_section__libc_csu_fini__ctype_toupper_loc@@GLIBC_2.3Prim_float_environmentPrim_stack_address_offsetasm_generic_subtractinterpreter_applicable_pOS_signal_tstp_handlerPrim_float_rounding_modesfegetexcept@@GLIBC_2.2condition_restart_findPrim_initialize_C_compiled_blockgetpwnam@@GLIBC_2.0Prim_set_working_dir_pathnamecos@@GLIBC_2.0option_batch_modePrim_write_word_to_memoryPrim_integer_subtract_1gc_precheck_fromPrim_tty_command_beepPrim_channel_readcomp_unassigned_p_trap_restartPrim_with_history_disabledOS_file_accessscheme_to_interfaceOS_open_output_fileospeedPrim_bit_string_movec_xOS_initializePrim_get_float_rounding_modeDebug_PrintPrim_local_assignmentOS_save_external_statearg_ulong_index_integerPrim_flonum_normalizestrcmp_ciTerm_NamesPrim_equal_fixnumPrim_recordPrimitive_Procedure_Tablecstack_pushPrim_scan_forward_to_wordPrim_enable_interruptsPrim_binary_fasloadsyntax_code_specPrim_create_tcp_server_socketPrim_get_host_namePrim_pty_master_send_signalOS_NameOS_process_reasonPrim_re_match_bufferdup2@@GLIBC_2.0setitimer@@GLIBC_2.0OS_open_load_filecallback_lunseal__snprintf_chk@@GLIBC_2.3.4option_emacs_subprocessget_trap_kindOS_restore_internal_statePrim_integer_bitwise_andc2sighnd_console_resizesighnd_renice_wrapperPrim_set_string_lengthPrim_nanotime_since_utc_epochRESTORE_CONT_RETURN_MESSAGEgc_vectorread_uuo_frame_sizePrim_lexical_referencePrim_gcd_fixnumPrim_float_underflow_exceptionuintmax_to_bignumexecute_reload_cleanupsinteger_bitwise_xorPrim_local_referenceoutf_flush_errorPrim_with_interrupt_masklog@@GLIBC_2.0mmap_heap_mallocPrim_flonum_truncatestore_trampoline_insnscompiler_new_subproblemPrim_peek_cstringparg_symbolset_ulong_registerasm_serialize_cachePrim_utility_index_to_namebignum_multiplyUX_initialize_signalsmake_microcode_identification_vectorgc_space_neededPrim_file_length_newPrim_new_directory_read_matchPrim_get_primitive_nameasm_generic_lessPrim_run_callbackasm_generic_addPrim_fixnum_andcPrim_process_jc_status_obstack_newchunkarg_doublesighnd_hardware_trapinterface_to_schemeStatic_Primitive_Procedure_Table__vfprintf_chk@@GLIBC_2.3.4grantpt@@GLIBC_2.1open64@@GLIBC_2.1Prim_peek_longPrim_match_forwardPrim_vec_8b_find_prev_charOS_process_any_status_changePrim_integer_nonnegative_one_bitsUX_ctty_save_internal_statePrim_encode_timePrim_primitive_purifyOS_process_statusPrim_terminal_set_ospeedgetlogin@@GLIBC_2.0OS_process_interruptOS_process_deallocateOS_open_unix_stream_socketPrim_system_call_error_messageexport_renumbered_primitivesia32_cpuid_supportedload_renumber_tablegc_handle_pairread@@GLIBC_2.0write_to_fasl_filesighnd_interactivePrim_gc_space_statusOS_pty_master_continuere_matchunspecificPrim_vec_8b_find_next_charUX_out_of_files_psse_read_mxcsroption_fasl_filetermination_eofinteger_hamming_distancearg_index_integer_to_intmaxPrim_band_dumpPrim_get_primitive_addresserror_bad_range_argPrim_scheme_program_nameOS_terminal_get_statedata_startsighnd_interactive_wrappergc_type_mapoption_unused_argcPrim_termcap_goto_stringget_interrupt_maskPrim_vec_8b_find_next_char_ci__environ@@GLIBC_2.0getpwuid@@GLIBC_2.0Prim_poke_ulongOS_ctty_interrupt_controlread_tospaceOS_terminal_cooked_output_pPrim_flonum_tanPrim_bit_string_allocateOS_channel_table_sizeStatic_Primitive_Arity_Tabletimes@@GLIBC_2.0set_interrupt_maskPrim_bignum_less_pPrim_vector_pasm_sc_applyPrim_new_file_open_io_channelPrim_float_divide_by_zero_exceptioninitialize_interruptable_extentPrim_alloc_selregfflush@@GLIBC_2.0gc_no_cc_supportPrim_current_user_home_directoryptrvec_allocatePrim_sys_pair_cdrsignal_interrupt_from_primitivePrim_bit_string_or_xPrim_integer_dividefeholdexcept@@GLIBC_2.1OS_tty_next_interrupt_charOS_process_table_sizetcflush@@GLIBC_2.0search_path_for_fileverify_heapbignum_bitwise_iorOS_process_killwithin_c_stack_restorePrim_have_ptys_pconstant_endPrim_object_type_pcompiler_processor_typedup@@GLIBC_2.0tputsPrim_peek_cstringp_bangstderr@@GLIBC_2.0Prim_greater_fixnumPrim_trappable_float_exceptionsPrim_substring_downcasePrim_get_environment_variableOS_channel_read_exit@@GLIBC_2.0Prim_flonum_ceiling_to_exactPrim_file_eq_pgc_handle_ephemeronUX_ctty_save_external_statesystem_pair_consC_Frame_Pointerunpack_control_pointinteger_dividesigprocmask@@GLIBC_2.0Prim_bignum_multiplyPrim_zeroephemeron_countcomp_link_caches_restartarg_integerPrim_primitive_procedure_docasm_nofp_equaltrampoline_to_interfaceintern_symbolPrim_flonum_sqrtUX_prim_check_fd_errnoOS_file_link_softbignum_bitwise_norinteger_zero_pPrim_tty_input_channelobstack_freePrim_integer_first_set_bitPrim_dld_load_fileOS_process_idPrim_stack_top_addressbignum_bitwise_notStatic_Primitive_Count_TablePrim_pty_master_continueOS_file_removememmove@@GLIBC_2.0OS_ctty_disabled_charPrim_peek_pointerPrim_current_user_nameRe_Enter_Interpreter_setjmp@@GLIBC_2.0compiled_closure_objectsPrim_sys_pairUX_ctty_restore_external_stateOS_deallocate_select_registryPrim_prim_make_objstruct_to_scmPrim_terminal_get_ospeedPrim_multiply_fixnumasm_nofp_negativePrim_restartable_exitPrim_cast_ieee754_single_to_integerPrim_channel_descriptorinteger_length_in_bitsPrim_pty_master_quitfree@@GLIBC_2.0Static_Primitive_Name_TablePrim_integer_lengthPrim_fixnum_orPrint_Primitivefesetenv@@GLIBC_2.2sighnd_dead_subprocess_wrapperOS_ctty_get_int_char_handlersPrimitive_Documentation_Tablesighnd_console_resize_wrapperPrim_object_gc_typePrim_pty_master_interruptPrim_flonum_expOS_signal_int_handleroutf_flush_consoleexit_interruption_extentPrim_set_interrupt_enablesarg_extended_stringUX_read_file_statusPrim_char_poption_saved_argcPrim_positivePrim_get_user_home_directoryapply_compiled_procedureinit_exit_schemememcpy@@GLIBC_2.0bignum_shift_lefttrampoline_entry_sizeOS_open_exclusive_output_filePrim_file_set_positioncomutil_primitive_applyOS_get_host_nameread_uuo_target_no_relocerror_unimplemented_primitiveOS_malloc_initOS_channel_synchronizebignum_bitwise_orc1tcsetpgrp@@GLIBC_2.0Prim_prim_obj_addressPrim_channel_tablePrim_flonum_logarg_alienPrim_file_type_indirectscheme_in_foregroundOS_make_subprocessasm_generic_equalINSTALL_HANDLERscratch_obstackmemory_block_endPrim_hunk3_consUX_initialize_cttyPrim_index_fixnum_putility_tablecc_closure_to_entryPrim_char_ascii_pPrim_scheme_environmentOS_tty_input_channelstart_operator_relocationasm_primitive_errorPrim_under_emacs_pPrim_floating_vector_lengthcompiled_closure_countPrim_return_to_ccallback_run_kernelOS_directory_openPrim_flonum_to_bignumwrite_variable_cachePrim_bit_string_reflong_to_bignumvoutf_fatalterminal_state_bufferedbignum_make_zerolookup_variableoption_disable_core_dumpPrim_UX_make_subprocessPrim_inexistentPrim_re_search_substr_forward_edataPrim_vector_consPrim_record_pgc_raw_address_to_objectPrim_poke_longsighnd_software_trapinitialize_interrupt_mask_vectorfclose@@GLIBC_2.1rmdir@@GLIBC_2.0type_namestime@@GLIBC_2.0RESTORE_CONT_EXPR_MESSAGEprimitive_table_export_lengthPrim_sys_subvector_to_listPrim_vec_8b_refOS_file_link_hardPrim_bignum_subtractx87_trap_exceptionsfesetround@@GLIBC_2.1bignum_bitwise_xorcomutil_operator_4_0_trapcomutil_unassigned_p_trapfind_symbolcompiler_var_errorvoutf_errorPrim_process_continue_foregroundPrim_host_address_anyPrim_get_unused_command_linecondition_handler_bindcfsetospeed@@GLIBC_2.0OS_process_send_signalPrim_dealloc_selregPrim_flonum_truncate_to_exactcomutil_quotientinteger_nonnegative_one_bitsPrim_re_search_buffer_forwardasm_primitive_lexpr_applyFree_primitiveread_command_line_optionssse_write_mxcsrcontrol_point_endtgotoOS_file_type_indirectPrim_set_cell_contentsPrim_poke_uchargc_precheck_from_no_transportfaslhdr_utilities_endPrim_flonum_asinarg_nonnegative_integeradd_reload_cleanupsignal@@GLIBC_2.0Prim_peek_ushortdstack_set_positionoption_force_interactiveexpm1@@GLIBC_2.0compiler_interrupt_commonmemcmp@@GLIBC_2.0OS_open_tcp_stream_socketPrim_positive_fixnumPrim_integer_less_pgc_handle_cellPrim_integer_bitwise_orc1Prim_termcap_get_stringPrim_non_restartable_exitrequest_timer_interruptsoft_resetOS_channel_typecomutil_return_to_interpreterPrim_outf_errorPrim_flonum_negatePrim_set_file_modescomutil_zeroOS_ctty_set_interrupt_enablesPrim_sys_list_to_vectorOS_make_pipegettimeofday@@GLIBC_2.0Prim_poke_ushortbignum_make_onePrim_sys_vec_seterror_out_of_channelsPrim_flonum_denormalizeOS_ctty_get_interrupt_enablesPrim_set_string_maximum_lengthcc_block_environmenttermination_no_error_handlerarg_ulong_integercallback_returncomutil_moduloOS_have_ptys_pPrim_make_subprocessflovec_refdstack_resettermination_init_errorPrim_forceguarantee_interp_returnclose_fasl_output_filePrim_error_procedurebignum_first_set_bitsighnd_dead_subprocesschdir@@GLIBC_2.0OS_open_pty_masterincrement_tospace_ptrimport_primitive_tableinitialize_gc_tablebkpt_proceedinteger_bitwise_andc2Prim_char_to_asciiPrim_scan_word_backwardPrim_process_hangupUX_ctty_restore_internal_stateguarantee_extra_ephemeron_spacePrim_read_byte_from_memoryPrim_floating_vector_cons_finiPrim_set_trapped_float_exceptionspow@@GLIBC_2.0ctime@@GLIBC_2.0Prim_real_gidread_uuo_symbolPrim_trap_float_exceptionssighnd_control_x_wrapperterminal_state_rawtermination_end_of_computationPrim_find_prev_char_in_setclear_bit_stringre_search_backwardOS_get_service_by_namemktime@@GLIBC_2.0Prim_match_backwardbignum_bitwise_andc2Prim_get_primitive_countsinteger_equal_pPrim_file_removeOS_set_trap_statePrim_file_acc_timegethostbyaddr@@GLIBC_2.0Prim_unbind_variableOS_real_timer_set__stack_chk_fail@@GLIBC_2.4Prim_bkpt_proceedOS_ctty_quit_charcc_entry_to_block_addressPrim_catchPrim_file_time_to_stringallocate_bit_stringReturn_NamesPrim_re_char_set_adjoindlclose@@GLIBC_2.0bignum_to_doublePrim_debugging_printerOS_file_directory_padd_to_tospacesysconf@@GLIBC_2.0Prim_integer_pgc_handle_broken_heartptrvec_move_rightasm_nofp_subtractPrint_Expressionabort_to_cfinite_flonum_pPrim_plus_fixnumenter_interruption_extentPrim_real_timer_clearPrim_lesscomutil_operator_lexpr_trapPrint_One_Continuation_Framegetuid@@GLIBC_2.0cfgetispeed@@GLIBC_2.0read_fasl_headerOS_channel_open_pPrim_file_touchPrim_substring_move_rightfeupdateenv@@GLIBC_2.2bignum_bit_countPrim_bignum_quotientfeclearexcept@@GLIBC_2.2Do_Micro_Errorgetpgrp@@GLIBC_2.0Prim_terminal_nonbufferedPrim_string_refptrvec_deallocatePrim_rehashOS_error_code_to_syserrflovec_lengthOS_get_host_by_addressalien_addressPrim_set_debug_flagsPrim_host_address_loopbackPrim_sys_vector_refvoutfPrim_flonum_integer_pset_ptr_registererror_external_returnPrim_file_accessasm_nofp_incrementPrim_bit_string_equal_pcomp_interrupt_restartPrim_file_link_softPrim_reload_retrieve_stringPrim_hostnameinteger_first_set_bitlookup_external_stringUX_reset_terminalsinteger_to_uintmax_pOS_signal_set_interrupt_handlersPrim_verify_heapPrim_floating_vector_refOS_channel_copyPrim_new_make_pipePrim_flonum_multiplybignum_to_ulongasm_generic_decrementPrim_bignum_negative_pcomutil_operator_4_3_trapsync_file_range@@GLIBC_2.6integer_subtract_1bind_interpreter_statePrim_scan_list_forwardPrim_file_open_exclusive_output_channelPrim_subtractPrim_record_refliarc_object_file_prefixPrim_poke_uintdlerror@@GLIBC_2.0geteuid@@GLIBC_2.0OS_reallocOS_baud_rate_to_indexbkpt_installrequest_console_resize_interruptterminal_state_get_ispeedcheck_fasl_cc_versioni386_reset_hookunlink@@GLIBC_2.0tty_set_next_interrupt_charPrim_unbound_testPrim_file_renamePrim_systemwrite_tospacePrim_process_idgc_handle_undefinedinteger_bitwise_andsighnd_control_bPrim_file_type_directexport_primitive_tablePrim_substring_upcasegc_no_transport_wordsPrim_record_settparmPrim_string_lengthPrim_c_mallocPrim_peek_cstring_bangPrim_cell_contentsasm_interrupt_closurePrim_fixnum_negatePrim_map_code_to_addressOS_restartable_exitasm_primitive_applyarg_to_channelbignum_equal_pscheme_program_namePrim_fixnum_remainderPrim_comp_code_address_offsetPrim_current_gid_IO_putc@@GLIBC_2.0asm_fixnum_shiftPrim_fixnum_notterminal_state_cooked_outputOS_test_select_descriptorsighnd_control_xreadlink@@GLIBC_2.0C_Stack_PointerPrim_current_pidsse_presenceinteger_bitwise_orc2bignum_quotientPrim_flonum_modulobignum_max_digit_stream_radixPrim_flonum_addcc_block_linkage_infoplausible_cc_block_pchannel_tableRegistersPrim_zero_fixnum_passign_variablePrim_peek_charsighnd_timergetsockopt@@GLIBC_2.0Prim_poke_floatdecode_old_style_format_wordOS_channel_write_dump_filecheck_number_of_argsPrim_dividevariable_unbound_pPrim_termcap_initializePrim_quotientscheme_jc_statusasm_nofp_greaterOS_nanotime_since_utc_epochOS_process_status_syncgetegid@@GLIBC_2.0UX_reinitialize_ttygc_scan_oldspaceposix_madvise@@GLIBC_2.2terminal_state_set_ospeedOS_open_io_fileia32_cpuid_neededioctl@@GLIBC_2.0Prim_get_service_by_namePrim_channel_blockingoutfPrim_float_invalid_operation_exceptionPrim_install_bkptPrim_integer_zero_pfopen64@@GLIBC_2.1ptrvec_copybignum_hamming_distancePrim_write_float_to_memoryPrim_read_float_from_memoryasm_errorwrite_cc_entry_typechar_downcaseinteger_negative_pcompiled_closure_entry_to_targetOS_job_control_pstd_gc_pt1Prim_scan_sexps_forwardtgetflagPrim_quoted_char_pcstack_topPrim_with_stack_markerchar_descriptioncomutil_operator_3_2_trappoll@@GLIBC_2.0accept@@GLIBC_2.0OS_host_address_lengthpointer_valuedigit_stream_to_bignumfwrite@@GLIBC_2.0compiler_cache_global_operatorOS_terminal_get_ispeedlinkage_section_typechar_pointer_to_string_no_gcPrim_length_obstack_allocated_pPrim_real_uidPrim_termcap_get_number__fxstat64@@GLIBC_2.2stack_endcomutil_errorPrim_invoke_C_thunkPrim_flonum_expm1Prim_shutdown_socketOS_pty_master_hangupPrim_divide_fixnumOS_process_quitdouble_to_fixnumPrim_sh3_set_1waitpid@@GLIBC_2.0Prim_addcomutil_primitive_errorfixnum_to_longPrim_re_compile_fastmapsafe_lookup_variableOS_pty_master_interrupttree_lookupPrim_profile_timer_setcritical_section_hook_ptermination_signalPrim_flonum_acosPrim_directory_deleteUPencode_old_style_format_wordOS_file_renameflonum_integer_parg_real_in_rangePrim_increment_freetgetentPrim_gid_to_stringUX_closefromcomutil_compiled_code_bkptPrim_peek_doublecomutil_interrupt_ic_proceduregc_handle_tripleUX_SC_CLK_TCKinteger_less_pOS_ctty_int_charcondition_restart_bindPrim_canonical_host_nameError_Namesfread@@GLIBC_2.0real_number_to_doublePrim_peek_ucharasm_trampoline_to_interfacePrim_fixnum_quotientprocess_tableasm_interrupt_procedureskip_compiled_closure_paddingstrcpy@@GLIBC_2.0OS_have_select_pPrim_integer_subtractOS_ctty_tstp_charBack_TracePrim_multiplyinstall_primitiveinteger_lengthPrim_flonum_subtractinteger_shift_rightPrim_integer_remainderOS_profile_timer_cleargetpid@@GLIBC_2.0userio_read_charasm_nofp_moduloPrim_poke_charx87_read_control_wordasm_dont_serialize_cacheOS_process_continuable_putility_index_to_nameasm_generic_negativeasm_sc_apply_size_2Prim_bit_string_pPrim_flonum_dividereturn_to_compiled_codeasm_sc_apply_size_4OS_current_user_home_directoryflonum_floorPrim_sys_h3_1terminal_state_get_ospeedacos@@GLIBC_2.0transaction_commitasm_sc_apply_size_6tcsetattr@@GLIBC_2.0comutil_lessOS_test_select_registryPrim_sys_set_cdrPrim_process_deletecc_entry_closure_ptcdrain@@GLIBC_2.0search_for_library_filePrim_lexical_reference_typedouble_is_finite_pPrim_tty_get_interrupt_enablesOS_directory_deletePrim_substring_lessclose_fasl_input_fileasm_interrupt_continuationPrim_listify_bignumPrim_write_bits_xOS_process_status_sync_allgethostname@@GLIBC_2.0asm_sc_apply_size_8newspace_to_tospacecstack_popOS_file_touchcomutil_interrupt_continuationtgetnumrequest_suspend_interruptlink_variablesPrim_flonum_positive_pupdate_weak_pointersPrim_less_fixnumPrim_bit_string_zero_pflovec_loctospace_available_parg_terminalasm_nofp_lessbkpt_removeOS_terminal_buffered_pOS_open_fdStatic_Primitive_Documentation_TableOS_channel_nonblockingcomutil_decrementPrim_vec_8b_setPrim_bignum_remainderobstack_chunk_allocbignum_to_integercontrol_point_startmake_uuo_linkPrim_process_reasonPrim_notPrim_remainderPrim_file_open_append_channelcompiler_utilitiesPrim_re_search_substr_backwardOS_encode_timeasm_generic_multiplyabort_to_interpreter_argumentPrim_prim_obj_datumgetenv@@GLIBC_2.0realloc@@GLIBC_2.0Prim_integer_addapply_compiled_from_primitiveasm_scheme_to_interfacelast_return_codestatfs64@@GLIBC_2.1abort_to_interpreterPrim_poke_shortPrim_trapped_float_exceptionsPrim_microcode_library_pathbignum_bitwise_andmalloc@@GLIBC_2.0Prim_char_codefind_primitiveppoll@@GLIBC_2.4arg_integer_to_intmaxprev_restore_history_offset__data_startreset_historycomutil_operator_lookup_trapUX_initialize_userioPrim_process_statusPrim_instruction_address_to_compiled_code_blockasm_nofp_remainderOS_terminal_raw_outputPrim_clear_float_exceptionsre_max_failuresreset_interruptable_extentsighnd_terminateUX_initialize_environmentflonum_roundflonum_denormalizeOS_channel_closeephemeron_request_hard_pPrim_greaterfixed_objects_namesPrim_channel_closeasm_generic_greaterPrim_coerce_to_closureerror_out_of_processesinteger_to_ulongfind_signal_namePrim_peek_floatinteger_to_long_pPrim_integer_shift_rightinteger_to_doublePrim_one_plus_fixnumsystem@@GLIBC_2.0InterpretPrim_flonum_less_pOS_directory_readwithin_c_stack_from_cOS_terminal_flush_inputasm_nofp_dividePrim_get_service_by_numberC_to_interfaceuserio_read_char_rawPrim_m_1_plus_fixnuminterface_to_Cbit_string_setbignum_comparePrim_hunk3_set_cxrasm_nofp_addffi_obstackOS_tty_command_clearPrim_make_ephemeronPrim_termcap_pad_stringOS_process_continue_backgroundPrim_negative_fixnumfesetexceptflag@@GLIBC_2.2re_search_forward_obstack_beginPrim_minus_fixnumPrim_file_exists_direct_pPrim_microcode_identifyoption_unused_argvPrim_channel_typePrim_subvector_move_rightPrim_file_mod_time_indirectstrerror@@GLIBC_2.0Prim_make_non_ptr_objectcompiler_cache_operatorPrim_prim_obj_type_pPrim_flonum_atan2x87_read_environmentasm_generic_zerosighnd_fpedouble_to_bignumOS_mallocarg_baud_indexcompiled_closure_startmodf@@GLIBC_2.0OS_terminal_set_ispeedinteger_remaindercomutil_remainderPrim_set_cdrunbind_variableinteger_negative_zero_bitsPrim_file_system_typecallout_popPrim_bkpt_pptsname@@GLIBC_2.1comutil_operator_3_1_trapOS_process_hangupPrim_return_stepasm_generic_incrementPrim_full_hostnamePrim_set_current_history__gmon_start__comutil_reflect_to_interfaceopen_tospacen_ephemerons_requestedPrim_file_copyn_stack_blocksPrim_subvector_move_leftPrim_string_maximum_lengthPrim_zero_fixnumOS_decode_timeobject_in_constant_space_pPrim_float_overflow_exceptionUX_initialize_channelscomutil_safe_lookup_trapexit@@GLIBC_2.0Prim_raise_float_exceptionsPrim_new_tcp_server_connection_acceptdeliver_pending_interruptsflonum_is_finite_pPrim_file_mod_timetrappingkill@@GLIBC_2.0error_floating_point_exceptionnice@@GLIBC_2.0fegetround@@GLIBC_2.1OS_tty_y_sizePrim_bignum_zero_pOS_open_dump_fileia32_cache_synchronizeOS_VariantPrim_terminal_cooked_outputget_band_parametersstop_signal_defaultPrim_integer_negatemake_vectorPrim_flonum_abserror_with_argumentdstack_initializeOS_get_service_by_numberlog1p@@GLIBC_2.0Prim_terminal_get_stateenter_interruptable_extentcc_entry_to_block_offsetOS_file_copyMicrocode_Terminationsetup_interruptinteger_bit_countPrim_unassigned_testsighnd_control_g_wrapperchar_pointer_to_stringulong_to_integerPrim_update_float_environmentPrim_impurifyUX_channel_descriptorPrim_string_allocate_IO_stdin_usedunbind_interpreter_stateOS_file_positionarg_interned_symbolPrim_file_open_io_channelcons_alienPrim_decode_utcPrim_string_setUX_file_system_typecc_entry_address_to_block_addresstree_freesetsid@@GLIBC_2.0asm_generic_modulox87_write_environmentOS_process_waitOS_real_time_clockend_subproblemPrim_subvector_to_listdstack_bindcc_block_debugging_infoOS_terminal_state_sizePrim_comp_code_address_blockinteger_to_intmax_parg_alien_entrylocaltime@@GLIBC_2.0Prim_setup_timer_interruptcritical_section_hookrename@@GLIBC_2.0gc_handle_quadrupleguarantee_cc_returnunblock_signalstree_buildsave_internal_statecomutil_cache_lookup_applyMAX_RETURNPrim_restore_float_exception_flagsflonum_ceilingPrim_flonum_sinPrim_scan_backward_prefix_charsstrtoul@@GLIBC_2.0OS_expect_sequential_accesscomutil_compiled_closure_bkptPrim_file_positionOS_terminal_bufferedPrim_garbage_collectPrim_object_typeOS_pty_master_quitcomutil_operator_4_2_trapgetcwd@@GLIBC_2.0sighnd_hardware_trap_wrapperfegetenv@@GLIBC_2.2stack_guardPrim_integer_bitwise_andc1sighnd_software_trap_wrapperPrim_unsigned_to_bit_stringOS_freePrim_file_attributessighnd_control_uUX_reset_channelsPrim_eqDebug_Stack_Tracecompiled_entry_filenamefscanf@@GLIBC_2.0terminal_openscheme_to_interface_returnpc_to_utility_indexasm_linkPrim_file_remove_linkstrlen@@GLIBC_2.0ctermid@@GLIBC_2.0Prim_poke_intptrvec_memqPrim_open_pty_mastercfgetospeed@@GLIBC_2.0fsync@@GLIBC_2.0callout_continuePrim_sys_pair_consmake_cc_entry_typePrim_sys_set_carsin@@GLIBC_2.0variable_unassigned_pPrim_scode_evalheap_alloc_limitbignum_divideOS_real_timer_clearPrim_alloc_external_stringfind_primitive_cnamePrim_re_search_buffer_backwardPrim_char_to_syntax_code__libc_start_main@@GLIBC_2.0Prim_prim_obj_set_typedouble_to_scmPrim_cast_ieee754_double_to_integerPrim_process_killsighnd_control_gOS_error_code_to_messagePrim_peek_cstringexecve@@GLIBC_2.0write@@GLIBC_2.0gc_bad_typeOS_encoded_timePrim_get_host_by_namePrim_tty_get_interrupt_charsinitialize_history_obstack_freeopen_fasl_input_filecanonicalize_primitive_contextcondition_type_deallocatecompiler_assignment_trapUX_terminal_set_statePrim_bit_string_to_unsignedPrim_char_upcaseStack_Deathoutf_fatalbignum_subtractPrim_scan_list_backwardreturn_to_interpreterinitialize_primitivesOS_restore_external_statePrim_within_control_pointstart_closure_relocationPrim_ascii_to_charalienate_float_environmentheap_reservedOS_decode_utccfsetispeed@@GLIBC_2.0term_messagesPrim_new_directory_readPrim_vector_refPrim_negativePrim_process_timer_clearOS_add_to_select_registryPrim_tty_set_interrupt_enablesPrim_terminal_bufferedCONT_PRINT_EXPR_MESSAGEPrim_profile_timer_clearOS_server_connection_accepttrampoline_storageasm_interrupt_dlinkUX_initialize_child_signalsinteger_shift_leftuserio_choose_optionbignum_negative_zero_bitsPrim_integer_quotientstack_pointererr_printgetpagesize@@GLIBC_2.0std_gc_tablePrim_type_to_gc_typeOS_directory_closedeclare_primitivegc_handle_manifest_closurePrim_builtin_index_to_namePrim_fixnum_xorcomutil_assignment_trapdeclare_compiled_code_blockinterpreter_statecc_block_closure_pgc_handle_nmvUX_terminal_get_statecompiler_interface_versionarg_pointerOS_bind_tcp_server_socket__libc_csu_initptrvec_move_leftOS_syscall_namesstrengthen_symbolcondition_allocatePrim_flonum_floor_to_exactfcntl@@GLIBC_2.0sighnd_stopread_cc_entry_typearg_channelterminal_state_nonbufferedPrim_record_lengthmemory_to_symbolPrim_dealloc_external_stringPrim_link_variablessigaddset@@GLIBC_2.0OS_select_registry_resultPrim_read_word_from_memoryPrim_channel_writecompiled_closure_nextgc_object_to_raw_addresscstack_depthsyntax_spec_codePrim_lexical_assignmentcomutil_operator_1_0_trapPrim_fixnum_andPrim_new_file_open_output_channelPrim_poke_stringbind@@GLIBC_2.0new_reductiondlsym@@GLIBC_2.0Prim_string_hash_modPrim_with_interrupts_reducedintmax_to_bignumPrim_peek_uintsigfillset@@GLIBC_2.0sighnd_terminate_wrapperPrim_bit_string_set_xgc_handle_weak_pairfegetexceptflag@@GLIBC_2.2back_out_of_primitiveoutf_consolegetgid@@GLIBC_2.0Prim_sys_vectorterminal_state_raw_outputdstack_positionPrim_char_bitsmake_primitivegmtime@@GLIBC_2.0Prim_get_freebignum_nonnegative_one_bitsallocate_stringmkdir@@GLIBC_2.0termination_gc_out_of_spacecomp_safe_lookup_trap_restartgetservbyname@@GLIBC_2.0integer_to_ulong_pPrim_string_to_symboloption_show_helpPrim_pure_prenumbered_primitives_export_lengthfixed_objectscompiler_cache_lookupOS_process_continue_foregroundPrim_termcap_param_stringPrim_fixnum_to_flonumoption_saved_argvcomutil_minusptrvec_set_lengthPrim_untrap_float_exceptionsPrim_baud_rate_to_indexarg_ulongtan@@GLIBC_2.0OS_current_user_nameOS_directory_valid_pPrim_bignum_equal_pPrim_file_open_output_channel_end__errno_location@@GLIBC_2.0link@@GLIBC_2.0tcgetpgrp@@GLIBC_2.0OS_ctty_set_int_char_handlersterminal_state_cooked_output_ptransaction_abortsqrt@@GLIBC_2.0CONT_PRINT_RETURN_MESSAGEmake_prim_renumberreal_number_to_double_pPrim_request_interruptsPrim_tty_next_interrupt_charPrim_memqpointer_to_scmOS_canonical_host_namedo_bkpt_proceedstrncpy@@GLIBC_2.0Prim_flonum_ceilingPrim_integer_positive_pfetestexcept@@GLIBC_2.1Prim_file_link_hard_startasin@@GLIBC_2.0death_blowasm_sc_apply_genericShow_EnvPrim_tty_x_sizecallback_run_handlerPrim_have_select_pOS_ctty_fdPrim_integer_to_charPrim_channel_nonblocking_fp_hwPrim_integer_negative_zero_bitsPrim_link_filesave_historyread_from_fasl_filePrim_prim_obj_to_integertransaction_initializeasm_short_primitive_applyPrim_directory_makeenter_compiled_expressionPrim_initialize_liarc_object_fileUX_read_fd_statusPrimitive_Name_Tablechannel_allocatePrim_integer_bit_countcomutil_lookup_trapPrim_band_loadOS_channel_writeOS_quitdouble_valuePrim_flonum_roundPrim_poke_string_banginitialize_condition_systeminteger_quotientcomutil_lexpr_applyPrim_integer_bitwise_andPrim_integer_bitwise_eqvlinkage_section_countPrim_fixnum_lshOS_directory_makePrim_process_signalPrim_file_attributes_indirecterror_in_system_callfgetc@@GLIBC_2.0OS_file_set_positionOS_terminal_nonbufferedcomp_op_lookup_trap_restartPrim_float_inexact_result_exceptionPrim_disable_interruptscomutil_positiveallocate_non_marked_vectorOS_tty_output_channelPrim_working_dir_pathnameOS_announcementinteger_to_uintmaxPrim_unimplementedinteger_multiplysigsuspend@@GLIBC_2.0atan@@GLIBC_2.0Prim_match_backward_cibignum_to_uintmaxPrim_declare_compiled_code_blockPrim_bignum_adduserio_buffered_inputPrim_make_pipePrim_prim_addr_to_datumbignum_bitwise_orc2Prim_substring_equalcompiler_cache_assignmentPrim_batch_mode_pwrite_fasl_headerPrim_extended_string_lengthPrim_make_charcomutil_operator_3_0_trapcstack_lpopOS_process_stopOS_free_pagesulong_to_bignumOS_channel_read_load_fileterminal_state_buffered_pPrim_string_to_syntax_entrymmap64@@GLIBC_2.1option_stack_sizecc_entry_to_blockpipe@@GLIBC_2.0Prim_prim_obj_reffasl_raw_address_to_objectPrim_get_command_linecomutil_equalUX_dump_corePrim_compiled_entry_kindOS_process_clockarg_real_numberhunk3_consPrim_set_carPrim_tty_y_sizecompiled_with_stack_markercomp_assignment_trap_restartaccess@@GLIBC_2.0arg_longmake_compiled_continuation_typevfork@@GLIBC_2.0debug_edit_flagsinteger_subtractstdout@@GLIBC_2.0Prim_address_to_stringPrim_bit_substring_move_right_xsighnd_save_then_terminate_wrapperOS_file_existence_test_direct__strcpy_chk@@GLIBC_2.3.4asm_interrupt_continuation_2Prim_constant_pferaiseexcept@@GLIBC_2.2Prim_flonum_cosasm_safe_reference_trapinteger_add_1__bss_startPrim_process_interruptPrim_tty_set_interrupt_charsulong_to_scmis_alienPrim_file_open_input_channelPrim_poke_pointer_bangOS_channel_blockingPrim_poke_pointertparamOS_shutdown_socketPrim_process_waitPrim_test_sel_descfeenableexcept@@GLIBC_2.2OS_host_address_anyPrim_termcap_get_flagallocate_string_no_gcPrim_dld_unload_fileasm_nofp_positivePrim_terminal_get_ispeedPrim_rem_from_selregMAX_PRIMITIVEOS_tty_map_interrupt_charPrim_channel_blocking_pmainsighnd_fpe_wrapperx87_read_status_wordPrim_external_string_pPrim_file_acc_time_indirectasm_generic_divideoption_constant_sizePCdiscard_tospacestd_gc_deathblock_signalsbignum_to_intmaxfrexp@@GLIBC_2.0Prim_integer_add_1ftruncate64@@GLIBC_2.1Prim_prim_datum_to_addrdeactivate_handlerOS_process_foregroundable_pPrim_re_match_substringPrim_flonum_floorreset_memoryfixup_float_environmentPrim_prim_obj_typeprint_stackfasl_object_addresscondition_deallocatePrim_integer_bitwise_orc2double_roundPrim_add_to_selregPrim_selreg_lengthmax_trampolinestop_signal_hookUX_reset_processesPrim_set_float_rounding_modeasm_generic_positivePrim_flonum_zero_pbignum_bitwise_andc1Prim_listen_tcp_server_socketPrim_list_to_integerntp_adjtime@@GLIBC_2.1Prim_save_float_exception_flagscomutil_primitive_lexpr_applyi386_interface_initializeUX_initialize_trap_recovery__longjmp_chk@@GLIBC_2.11Prim_set_float_environmentoption_show_versionfill_bit_stringPrim_file_modesbignum_integer_lengthPrim_moduloPrim_process_quitgc_handle_cc_entryPrim_flonum_greater_pmunmap@@GLIBC_2.0history_registerFreen_heap_blocksx87_clear_exceptionsPrim_new_open_tcp_server_socketPrint_Returnread_uuo_linkOS_terminal_set_stateOS_open_append_fileOS_terminal_cooked_outputcomutil_operator_primitive_trapsigemptyset@@GLIBC_2.0reset_allocator_parameterscomutil_operator_4_1_trapPrim_tty_command_clearinitialize_fixed_objects_vectori387_presencePrim_terminal_flush_inputgc_scan_tospaceconsmemory_block_startPrim_integer_length_in_bitsPrim_string_hashcheck_fasl_versiongc_raw_address_to_cc_entryPrim_process_stopOS_channel_nonblocking_pPrim_scan_forward_prefix_charscompiler_new_reductiontermination_trapPrim_terminal_cooked_output_pinitialize_weak_chainPrim_new_file_open_append_channelchar_upcaseUX_prim_check_errnobignum_bitwise_eqvOS_ctty_num_int_charsPrim_set_file_timesOS_pausegc_cc_entrybignum_to_digit_streamheap_startOS_file_existence_testPrim_terminal_buffered_peta_fclosePrim_add_onePrim_unreferenceable_testPrim_integer_multiplyerror_process_terminatedOS_listen_tcp_server_socketempty_listtransaction_begincomutil_interrupt_continuation_2Prim_return_to_applicationPrim_string_poutf_errorPrim_reload_band_nameOS_allocate_select_registryset_alien_addressPrim_flonum_negative_pgc_handle_unaligned_vectorgc_transport_wordstree_error_messagePrim_process_status_syncdeclare_builtinUX_PC_VDISABLEfasl_raw_address_to_cc_entryPrim_integer_to_flonumlisten@@GLIBC_2.0hard_resetPrim_safe_lexical_referencecompiler_lookup_trapPrim_peek_intset_terminal_statePrimitive_Count_Tablecomutil_interrupt_procedurecomutil_applycompiled_closure_entrywrite_uuo_targetPrim_vec_8b_find_prev_char_cicomp_lookup_trap_restartdstack_protectlong_valueetextsighnd_control_b_wrappercomp_cache_lookup_apply_restartinteger_bitwise_andc1arg_addressPrim_bignum_positive_pPrim_system_clockinteger_bitwise_eqvinteger_bitwise_notpreserve_signal_maskptrvec_adjoinutime@@GLIBC_2.0Prim_set_fixed_objects_vectorPrim_integer_negative_pn_constant_blocksPrim_bit_string_and_xarg_integer_in_rangePrim_macosx_main_bundle_dirinteger_bitwise_norfputc@@GLIBC_2.0debug_back_traceoutf_flush_fatalPrim_flonum_exptsscanf@@GLIBC_2.0Prim_equal_numberPrim_prim_integer_to_objarg_ascii_charconstant_alloc_nextOS_channel_write_stringwrite_compiled_closure_targetPrim_prim_fasdumperror_wrong_type_argtermination_normalPrim_pairPrim_new_open_unix_stream_socketsave_tospaceget_object_addressMulterminal_state_set_ispeedOS_file_type_directcompiler_resetOS_remove_from_select_registryPrim_real_timer_setPrim_tty_output_channelUX_initialize_ttywrite_cc_entry_offsetunlockpt@@GLIBC_2.1Prim_write_byte_to_memoryOS_process_valid_pre_buffer_initializePrim_gc_trace_referencesinitial_C_stack_pointerPrim_set_trap_stateintmax_to_integercompiler_operator_reference_trapasm_nofp_decrementPrim_char_downcasePrim_poke_bytesinteger_bitwise_nandPrim_read_bits_xPrim_encoded_timePrim_pty_master_hangup_Jv_RegisterClassessymlink@@GLIBC_2.0Prim_flonum_equal_pOS_file_lengthPrim_peek_bytesarg_ascii_integerPrim_make_bit_stringallocations_ok_plong_to_integerdstack_alloc_and_protectPrim_flonum_log1pvoutf_consoleopen_fasl_output_filenew_subproblemsighnd_control_u_wrappervariable_unreferenceable_psighnd_timer_wrappersetpgid@@GLIBC_2.0Prim_find_symbolPrim_integer_bitwise_norcomutil_negativeasm_generic_remaindercomutil_plustospace_to_newspacedebug_examine_memoryallocate_vectorPrim_bit_string_move_xcomutil_operator_apply_traprequest_character_interruptasm_scheme_to_interface_callPrim_cdrcondition_signalget_terminal_statetgetstrinteger_bitwise_orc1get_newspace_ptrreuse_subproblemPrim_object_datumPrim_non_restartable_exit_with_valueOS_pty_master_killasm_assignment_trapOS_resetread_compiled_closure_targetPrim_c_freeOS_process_timer_setPrim_integer_bitwise_xordstack_allocOS_create_tcp_server_socketPrim_floating_vector_setcopy_to_constant_spacegc_tuplePrim_peek_shortgc_handle_non_pointerUX_initialize_terminalsbignum_to_longPrim_new_file_open_input_channelPrim_hunk3_cxrgc_handle_reference_trapexp@@GLIBC_2.0find_ccblockstack_deathOS_set_working_dir_pathnamebignum_negatecomutil_interrupt_closurepending_interrupts_pPrim_assqbignum_shift_rightPrim_bit_string_fill_xprint_helplong_to_scmPrim_flonum_atanPrim_integer_bitwise_nandPrim_object_set_typeinteger_to_intmaxOS_process_jc_statususerio_confirmprim_apply_error_codestd_gc_pt2Prim_null_pchar_pointer_to_symbolOS_tty_command_beepPrim_liarc_compiled_code_blocksOS_syserr_namesPrim_integer_greater_pcondition_type_allocatePrim_process_status_sync_allPrim_baud_index_to_ratecompiler_initializeOS_working_dir_pathnamecondition_restartscomutil_operator_2_0_trapPrim_sh3_set_2comutil_multiplysubprocess_death_hookPrim_file_soft_link_pPrim_match_forward_ciPrim_subtract_onecallout_lunsealcompiled_with_interrupt_maskPrim_file_truncatePrim_terminal_set_stateobject_in_heap_punsigned_long_to_shifted_bignumactivate_handlerOS_terminal_set_ospeedPrim_primitive_procedure_arityMAX_STATIC_PRIMITIVEasm_reference_trapPrim_substring_ci_equalresize_tospaceUX_initialize_directory_readerclear_float_exceptionsPrim_list_to_vectorPrim_sh3_set_0Prim_environment_link_nameasm_nofp_quotientoption_heap_sizere_compile_fastmaprestore_historyldexp@@GLIBC_2.0bignum_to_fixnumPrim_decode_timePrim_channel_type_nameOS_pty_master_stoplseek64@@GLIBC_2.1Prim_cc_block_linkage_infoPrim_bind_tcp_server_socketbkpt_pweaken_symbolPrim_vec_8b_fillUX_terminal_control_okreaddir64@@GLIBC_2.2OS_host_address_loopbackbignum_to_flonumPrim_remove_bkptPrim_bit_string_clear_xPrim_test_selregread_uuo_targetcurrent_gc_tablePrim_scan_word_forwardoption_band_filePrim_integer_equal_pdlopen@@GLIBC_2.1integer_to_longPrim_file_directory_psocket@@GLIBC_2.0Prim_new_directory_opentree_insertPrim_bit_string_lengthPrint_Vectorcoerce_to_compiledUX_initialize_processescompiler_safe_lookup_trapPrim_sys_h3_0comp_error_restartcomutil_interrupt_dlink__fprintf_chk@@GLIBC_2.3.4Prim_poke_doubleasm_nofp_multiplyasm_generic_quotientPrim_substring_move_leftpc_to_builtin_indexPrim_sys_h3_2OS_process_timer_cleartrap_handlerbignum_length_in_bitsPrim_make_cellOS_terminal_drain_outputtransaction_record_actionPrim_defer_float_exception_trapsPrim_test_float_exception_flagssigaction@@GLIBC_2.0read_cc_entry_offsetPrim_integer_hamming_distancePrim_process_continue_backgroundasm_sc_apply_size_1Prim_bitstr_find_next_set_bitcallout_sealasm_sc_apply_size_7integer_negatePrim_apply_stepinteger_to_double_pallocate_marked_vectorfmod@@GLIBC_2.0asm_sc_apply_size_5compiler_unassigned_p_trapasm_sc_apply_size_3Prim_flonum_pPrim_vector_lengthPrim_fixnum_to_bignumgc_cc_entry_to_raw_addressephemeron_arraymemory_to_string_no_gcPrim_clear_interruptscomutil_linkstring_to_symbolsignal_error_from_primitivearg_ulong_integer_in_rangebuiltin_index_to_namePrim_integer_bitwise_iorPrim_integer_bitwise_notstrncmp@@GLIBC_2.0OS_tty_x_sizebignum_testPrim_terminal_drain_outputisatty@@GLIBC_2.0stop_historytcgetattr@@GLIBC_2.0environ@@GLIBC_2.0Prim_channel_synchronizePrim_general_car_cdrPrim_test_float_exceptionsPrim_reload_save_stringOS_terminal_flush_outputPrim_vector_setchmod@@GLIBC_2.0abort@@GLIBC_2.0Prim_bit_string_xor_xmadvise@@GLIBC_2.0gc_handle_aligned_vectorPrim_consoutf_flushinteger_bitwise_iorOS_select_registry_lengthmake_dummy_historyfdatasync@@GLIBC_2.0posix_openpt@@GLIBC_2.2.1Prim_process_timer_setPrim_eval_step__xstat64@@GLIBC_2.2Prim_terminal_raw_outputOS_under_emacs_pOS_expect_normal_accessPrim_new_file_open_exclusive_output_channelPrim_c_callcritical_section_nameAbort_NamesOS_terminal_get_ospeedfasl_cc_addressgethostbyname@@GLIBC_2.0Prim_new_open_tcp_stream_socketsighnd_save_then_terminateinteger_addinitialize_gcPrim_current_uidulong_value_obstackcomutil_incrementOS_ctty_get_int_charsuintmax_to_integerinitialize_interrupt_handler_vectorbignum_remaindercurrent_interruptable_extentshutdown@@GLIBC_2.0gc_type_codesighnd_renicePrim_carPrim_map_address_to_codePrim_get_fixed_objects_vectormemory_to_stringPrim_close_lost_open_filesPrim_bignum_length_in_bitsPrim_get_interrupt_enablesPrim_bit_string_andc_xPrim_c_call_continuestrtol@@GLIBC_2.0define_variablePrim_dld_lookup_symbolPrim_host_address_lengthPrim_applyfputs@@GLIBC_2.0executing_scheme_primitive_pheap_endconnect@@GLIBC_2.0OS_channel_close_noerrorbignum_fits_in_word_p__lxstat64@@GLIBC_2.2sighnd_stop_wrapperPrim_bignum_to_fixnumPrim_char_to_integerPrim_terminal_flush_output_initPrim_peek_ulongcallout_unsealOS_open_input_filePrim_pty_master_stopPrim_uid_to_stringPrim_channel_file_attributesPrim_terminal_set_ispeedclose@@GLIBC_2.0compute_extra_ephemeron_spaceOS_signal_quit_handlerclosedir@@GLIBC_2.0comutil_greaterconstant_startOS_file_remove_linkOS_get_host_by_namePrim_sys_vec_sizepreserve_interrupt_maskPrim_file_exists_pPrimitive_Arity_Tabletrampoline_entry_addrPrim_prim_obj_setPrim_pty_master_killmake_linkage_section_markerx87_write_control_wordwithin_c_stackatan2@@GLIBC_2.0reflect_to_interfacePrim_real_time_clockOS_pty_master_send_signalasm_nofp_zeroarg_index_integerPrim_new_directory_closeOS_channel_close_on_abortOS_baud_index_to_ratedouble_to_integeropendir@@GLIBC_2.0arg_flonumstack_startPrim_flonum_round_to_exactgetgrgid@@GLIBC_2.0setup_memoryPrim_sys_pair_carPrim_integer_shift_leftPrim_float_exceptionsflonum_normalizePrim_cell_pcomutil_operator_2_1_trapfedisableexcept@@GLIBC_2.2Prim_cast_integer_to_ieee754_doubleUX_read_file_status_indirectPrim_cc_closure_to_entryOS_profile_timer_setscheme_to_interface_call__ctype_b_loc@@GLIBC_2.3Prim_vectorPrim_vector_fillPrim_prim_obj_eq_pmake_compiled_procedure_typecomutil_dividePrim_cast_integer_to_ieee754_singlePrim_bignum_dividePrim_get_host_by_addressbignum_bitwise_nandBCgc_ptr_typedouble_truncatePrim_bignum_to_flonumbkpt_closure_install__sprintf_chk@@GLIBC_2.3.4double_to_flonumOS_directory_read_matchingOS_file_soft_link_pbignum_addRegstartOS_save_internal_stateasm_set_interrupt_enables