NIGMS
CONSORTIUM HOME CONTACT US SITE MAP LOGIN

Search
Home > Molecule Pages > Glycan Binding Proteins > Galectins > Galectin 3 (human)
 
Galectin 3 (human)
 
Protein Primary Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQP
AGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYHGAPGAYPGAPAPGVYPGPPSGPGAYP
SSGQPSAPGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQ
RGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFK
VAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI

Molecular Weight 26,100 Da
Sub-Unit Information Monomer, can form higher order homomultimers
SwissProt P17931 (LEG3_HUMAN)
Protein Sequence Alignment Blast Galectin 3 (human)
Signal Sequence  
Carbohydrate Recognition Domain (CRD)  
Biological Molecules Complexed Carbohydrate dependent
  • CEA
  • cytokeratins
  • Fc epsilon R
  • IgE
  • integrin alpha1-beta1
  • laminin
  • LAMP-1
  • LAMP-2
  • LPS=carbohydrate
  • Mac-2 BP-1/2
  • MP20
  • TCR complex
Carbohydrate independent
  • CBP70
  • Bcl-2
  • ss-DNA
  • galectin-3 CRD
  • LPS-lipid
  • RNA
Comments

Biophysical
PDB 1A3K
PDB Title X-ray crystal structure of the human galectin-3 carbohydrate recognition domain at 2.1-A resolution (PubMed)
PDB Experimental Method X-ray crystallography
Isoelectric Point 9.1 (Predicted)


 
 
 

© 2002-2003 Consortium for Functional Glycomics. All rights reserved.